KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_07525Help
Entry
A4R40_07525       CDS       T05478                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K07404  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00030  Pentose phosphate pathway
plum01100  Metabolic pathways
plum01110  Biosynthesis of secondary metabolites
plum01120  Microbial metabolism in diverse environments
plum01130  Biosynthesis of antibiotics
plum01200  Carbon metabolism
Module
plum_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
plum_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A4R40_07525
Enzymes [BR:plum01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     A4R40_07525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactonase SGL DUF4346
Motif
Other DBs
NCBI-ProteinID: AWK41346
LinkDB All DBs
Position
1773773..1774759
Genome map
AA seq 328 aa AA seqDB search
MKQVVYTASPNSCQIHVWSLNNEGELSLIQTVDVPGEVQPMVVSPDRKHLYVGIRPQFSI
VTYQIGSRGELAQQGISSIPGSPTHISTDKQGRFLFSASYSYNNLSVSLIDDQGIVGEPV
QVIAGLQAPHSANIDWDNKQLLVPCLKEDRVRIFEMAKEGYLTEKRAEEITTAMGAGPRH
MAFHPNQQVIYCINELDSTVDVYRKWEKYRTVQTVDSLPADLAGVRWSADIHITPDGRHL
YTSERTSSLISHFVISQDGSNLTLAGHYKTEIQPRGFAIDHSGKYLIASGQKSDHISVSS
IDKYTGKLTELTRYPVGKGPMWVTVLAL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtggtttatacggcgagtccaaacagttgtcagattcatgtttggagcctg
aataatgaaggtgagttatcactgattcagacagttgatgtaccgggggaagtacaacca
atggtggttagcccggatcgtaaacatctttatgttggcatccggccacaattcagtatt
gtcacttaccagattggctctagaggggaactggcacaacaggggatttcatcaataccg
ggtagcccgactcatatctctactgataaacagggccgttttctattctctgcctcctat
agttataacaatttgagtgtcagcctaattgatgatcaaggtattgtgggtgaacctgtt
caggttattgccggtttgcaagcaccgcattcggctaatattgactgggataataaacaa
ctattggttccttgtctgaaagaagatcgcgtccgtatttttgagatggcaaaagagggt
tatctgacagaaaaacgtgctgaggaaatcactaccgcaatgggtgcgggccctcgtcat
atggcatttcatccaaatcagcaggtgatttattgtattaatgaactggattctacagtg
gatgtttatcgcaagtgggaaaaatatcggactgttcagacggttgattcattgccggca
gatttagcgggagttcgttggtctgcggatattcatattacaccggatggtcgtcacctt
tataccagtgaacggacttcaagtttgatcagccattttgttatttcgcaagatggttct
aatttgacgctggcaggacactataaaactgaaattcagccgcgtggttttgctatcgat
cacagtggaaaatatctgattgcatccggtcaaaagtctgaccatatttcagtctcttct
attgataaatataccggtaaattgactgaattgacgcgctatccagtaggtaaaggccca
atgtgggtaacggtgctggccctgtga

DBGET integrated database retrieval system