KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_09815Help
Entry
A4R40_09815       CDS       T05478                                 

Definition
(GenBank) sulfurtransferase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00040  Pentose and glucuronate interconversions
plum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A4R40_09815
Enzymes [BR:plum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     A4R40_09815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N Pyr_redox_2 Pyr_redox_3 Methyltransf_25 DAO
Motif
Other DBs
NCBI-ProteinID: AWK41762
LinkDB All DBs
Position
complement(2330184..2331212)
Genome map
AA seq 342 aa AA seqDB search
MKALVLEKAGQISIQDWETPEILGENDVEIKIHSVGICGSDVHYYQYGRIGPFIVEKPMI
LGHEASGVITAVGKNVTHLKIGDRVCMEPGIPNLQSPQSRAGIYNLDPEVRFWATPPIDG
CLRERVIHPAAFTFKLPDNVSFAEGAMVEPLAIGMQAATKAEIKPGDIALVIGAGTIGIV
TALAALAGGCSDVIICDVFDEKLEIAKQYPGLHPVNSKVLTEKVNALTEGNGVNILFECS
GAKPVIATISEHIAPGGIAVLVGMPIDPAPFDVVSAQAKEITFKTIFRYANMYPRTIRLL
SSGKLKVTPLLSATYKFKDSVQAYERAAEGRPTDIKIMLEME
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattagtattagaaaaagcaggtcagatttcaattcaagactgggaaaccccc
gaaatattgggtgaaaatgatgttgaaataaaaattcactcggtggggatttgtggcagc
gatgtgcattattatcaatacgggcgtattgggccatttattgtcgaaaagccgatgatc
ctcgggcacgaagcatcaggtgtcatcaccgcagtaggtaaaaatgtgactcacttaaaa
atcggcgatcgtgtctgtatggaacctggcattcctaatctgcaatcaccacaatcacgg
gcaggtatttataacttagatccagaagtgcgtttctgggcgacgccccctattgatggt
tgcttacgtgaaagagttattcatccggcagcatttacgttcaaattaccggataatgtc
agttttgccgaaggtgcaatggttgaaccattagctatcggtatgcaagccgccacaaaa
gcagaaattaaaccaggagatatcgcattagttattggtgctggcacgatcggaattgtt
accgcacttgccgcattagccggtggttgttctgatgtcattatttgcgatgtgttcgat
gaaaagctagaaattgcaaaacagtatccaggtcttcacccggttaatagcaaagtactt
actgagaaagtgaatgcattaaccgagggtaatggcgtcaatattctctttgaatgtagt
ggcgcaaaaccggtcattgccactatttcagagcacattgcaccgggaggaatagctgtt
ctagtcggtatgcctatcgatccggcaccatttgatgttgtctctgctcaagctaaagag
atcacattcaaaactattttccgctacgcaaatatgtaccctcgtactattcgtttactt
agctcaggtaagctcaaagtaacccctctattatccgcaacctataaatttaaagacagc
gttcaggcgtatgaacgagccgcggagggtcgcccgacagatatcaaaattatgttggaa
atggagtaa

DBGET integrated database retrieval system