KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_12895Help
Entry
A4R40_12895       CDS       T05478                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A4R40_12895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plum02000]
    A4R40_12895
Enzymes [BR:plum01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A4R40_12895
Transporters [BR:plum02000]
 Other Transporters
  Pores ion channels [TC:1]
   A4R40_12895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AWK42334
LinkDB All DBs
Position
3037043..3037648
Genome map
AA seq 201 aa AA seqDB search
MKLYYQPGACSLSPHIILREAGLDFSVIKVDLKTKKTENGDDFFAINPKGQIPTLLLDNN
EILTEGSVIVQYIADQKPDKKLIAPAGTMERYRQLEWLSHISSEIHKGFSPLFFPGTPEN
YRPVAVNNLLRKFKYIDEVLAKQPYIAGEHFTVADAYLFTLSNWAPLVQLDLSDRVHLKA
YQERIAERPNVRDALKAEGLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttattaccaacctggagcttgttctctctcacctcacatcatactccgtgaa
gcagggcttgatttcagcgtgattaaagttgatctgaaaaccaaaaaaacggagaacggc
gacgatttcttcgcaatcaatccaaaaggccagatacccactcttctgttagataacaat
gagatcctcaccgaaggctctgttattgtccaatatattgccgaccagaaaccggacaaa
aaattaattgcaccagccggaacgatggaacgatatcgtcaacttgaatggcttagccat
atttccagtgaaattcataaaggattttcacctctgttttttccaggaacaccagaaaat
tatcgtcctgttgcggttaataatctactgagaaaattcaagtacatagatgaagtatta
gcaaaacagccatacattgccggggagcattttactgttgctgacgcttacttattcact
ctcagtaattgggcacctttagtgcaattggatctatctgatcgggttcatcttaaagct
tatcaagagaggattgcagaacgtccaaatgttcgtgatgcactgaaagcggaagggtta
atttga

DBGET integrated database retrieval system