KEGG   Photorhabdus laumondii subsp. laumondii DSPV002N: A4R40_21835Help
Entry
A4R40_21835       CDS       T05478                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
plum  Photorhabdus laumondii subsp. laumondii DSPV002N
Pathway
plum00071  Fatty acid degradation
plum00280  Valine, leucine and isoleucine degradation
plum00281  Geraniol degradation
plum00310  Lysine degradation
plum00362  Benzoate degradation
plum00380  Tryptophan metabolism
plum00410  beta-Alanine metabolism
plum00640  Propanoate metabolism
plum00650  Butanoate metabolism
plum00903  Limonene and pinene degradation
plum00930  Caprolactam degradation
plum01100  Metabolic pathways
plum01110  Biosynthesis of secondary metabolites
plum01120  Microbial metabolism in diverse environments
plum01130  Biosynthesis of antibiotics
plum01200  Carbon metabolism
plum01212  Fatty acid metabolism
Module
plum_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:plum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A4R40_21835 (fadB)
   00650 Butanoate metabolism
    A4R40_21835 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4R40_21835 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4R40_21835 (fadB)
   00310 Lysine degradation
    A4R40_21835 (fadB)
   00380 Tryptophan metabolism
    A4R40_21835 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A4R40_21835 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A4R40_21835 (fadB)
   00281 Geraniol degradation
    A4R40_21835 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4R40_21835 (fadB)
   00930 Caprolactam degradation
    A4R40_21835 (fadB)
Enzymes [BR:plum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A4R40_21835 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A4R40_21835 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A4R40_21835 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     A4R40_21835 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AWK43951
LinkDB All DBs
Position
5149376..5151562
Genome map
AA seq 728 aa AA seqDB search
MLYQSETIQVSWLKDGIAELVFNAPAAINKLDTKTVASLDKAIASLEQQTGLKGVLLRSE
KTAFIVGADITEFLSLFDSPVEKLQEWLNFSNSIFNRIEDLPVPTISAINGYALGGGCEC
VLSTDFRVASPDIRIGLPETKLGIMPGFGGSVRLPRLIGTDNALDIIAAGKDIGAEEALK
NGLIDAVVPKEKLVDSAVSMLEQAIAGNLDWKAARQPKLEPLKLNETERGMSFSVAKGMV
MKVAGPHYPAPITAVKSIEKAATFGRDEALKQETASFIPLAQTNVARALVGIFLNDQYVK
GLAKKHLKEVTIPEYAAVLGAGIMGGGIAYQSARKGIPVMMKDISQQSLELGMNEAAKLL
NKQFERGRLDAIKMARTLSSIQPTLNYAGIEQAQIVVEAVVENPKIKAAVLSETETLVNE
DCVLASNTSTIPISELAKSLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSEKTISTVVAY
ASKMGKTPIVVNDCPGFFVNRVLLPYLLGFGLLLRDGGDFRQIDKIMEKEFGWPMGPAYL
IDVIGLDTAHHSQSVMAQGFPDRMHRDYKDAIHVLYDNQRYGQKNGLGFYKYTQDKKGKP
KKEQDEQTDQLLATICQQKSNFSGEEIIARTMIPMINEVVRCLEEGVIASPAEADMALVY
GLGFPPFHGGVFRYLETMGTAAYVKMAENYAHLGALYQVPPGLKAKAERNESYYSTAATI
AVSTGKTA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgctctatcaaagtgaaacaattcaagtaagctggctgaaagatggcattgctgaactg
gttttcaatgccccagccgcgattaataaactagataccaaaaccgttgcatctctcgac
aaggctattgccagcctagagcaacaaactggattgaaaggcgttttattacgttctgaa
aaaaccgcatttattgttggtgcagatattactgaattcctctctttattcgattcacct
gtagaaaaactgcaagaatggcttaacttttcaaatagcatttttaaccggatagaagat
ttacctgtaccaaccatttcagcaataaacggttatgctcttggtggtggttgtgaatgc
gttctatctacagatttccgtgtggcctccccggatatacgcattgggttaccagaaacc
aaacttggtattatgcctggtttcggtggctcagttcgccttccacgcctgatcgggact
gataatgcattggatatcattgccgcaggtaaagacattggtgcagaagaagcattgaaa
aacggtttgattgatgctgttgttcccaaagaaaaactggttgattccgcagtatcaatg
ctggaacaagcaattgcagggaacctcgactggaaagccgcacgccagccaaaattagag
cctttgaaactcaatgaaactgaacgaggcatgagttttagtgtggcaaaaggtatggtg
atgaaagtcgccggccctcattatccagctcctatcaccgcagttaaatctatagaaaaa
gccgctacatttggtcgcgatgaagcattgaaacaagaaaccgccagcttcattccttta
gcacagacaaatgttgcccgtgccttagtgggtatttttcttaatgaccagtacgtaaaa
ggactggcaaaaaaacatctgaaagaagtcacaatacctgaatatgccgcagttctaggt
gctggaattatgggtggtggtatagcctatcaatccgcccgcaaagggattcctgtcatg
atgaaagacatcagccagcaatcccttgaattaggtatgaatgaagccgcgaaacttcta
aacaagcaatttgaacgtggccgtctagatgctataaaaatggcgagaaccctctcttct
attcaacctaccttaaattatgccggtatcgaacaggcccaaatcgtggttgaagctgta
gtagagaatcctaagatcaaagcggctgtactatcagaaactgaaactctggttaatgaa
gattgtgtcctagcttccaacacatcaacaattccaatttcagaattagctaagtcccta
aaacgcccggaaaacttctgtggtatgcatttcttcaacccggtacaccgcatgccgttg
gttgaagtcattcgcggtgaaaaaacgtctgaaaagacaatttcaaccgtagtcgcctat
gccagcaaaatgggtaaaactccgatcgtcgttaacgactgtccagggttctttgtaaac
cgagtactgcttccctatctccttggcttcggtctgctattgcgtgatggtggtgatttc
cgccaaatagacaaaatcatggagaaagaatttggttggccaatgggccctgcttacctt
atcgatgttattggtcttgatactgcacatcattctcaatccgtcatggcccaagggttc
ccagatcgtatgcatcgtgattataaagatgccattcatgttttatatgacaatcaacgt
tatgggcagaaaaacggccttggcttctataaatatacgcaagataagaaaggtaaacct
aagaaagagcaagacgagcaaacagaccaactgctggcaactatctgccaacagaagagt
aatttctccggtgaagagatcattgctcgtactatgatcccgatgatcaacgaagttgtc
cgttgtctggaagaaggtgtcattgccagcccagcagaagcagatatggctctggtttat
ggccttggcttccctccattccacggtggtgttttccgttatctggaaacaatgggaact
gcggcttacgtaaaaatggctgaaaattatgctcacctaggtgctctttatcaggtaccg
cctggtctgaaagccaaagctgaacgtaatgaaagttactactctacagcagcaacgatt
gctgtcagcaccggaaaaacagcgtga

DBGET integrated database retrieval system