KEGG   Paenibacillus lutimineralis: EI981_01450Help
Entry
EI981_01450       CDS       T06479                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
plut  Paenibacillus lutimineralis
Brite
KEGG Orthology (KO) [BR:plut00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EI981_01450 (ahpF)
Enzymes [BR:plut01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EI981_01450 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored Thi4 HI0933_like AlaDh_PNT_C FAD_binding_3 DAO K_oxygenase Glutaredoxin NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AZS13281
UniProt: A0A3Q9I5R0
LinkDB All DBs
Position
311468..313000
Genome map
AA seq 510 aa AA seqDB search
MKLDADIKSQLAQYLQLLEGNVLLKVSAGSDSVSNDMLDLVNELSGMSDKITVEHTTLPR
TPSFSVNRVGEDTGVTFAGVPLGHEFTSLVLALLQVSGRPPKVEQSVIDRIKAIQGVYHF
ETYVSLSCHNCPDVVQALNMMSVLNPNITHTMIDGAAFKEEVESKDIMAVPSVYLNAEFF
ESGRMTVEDILNKMGSSKDASEFDNKEPYDVLVVGGGPAGASAAIYAARKGIRTGIIAER
FGGQVNDTLGIENLIGTKYTEGPKLAASLEEHAKEYNIDIMKSQLAKRLEKKDFVEVELE
NGAILKSKTVIVSTGARWRNLGVPGEAEFKNKGVAYCPHCDGPLFAGKHVAVVGGGNSGI
EAAIDLAGVAGHVTVLEFMSELKADSVLQERLNSLPNTTVIKNAQVKEITGTNKVDGVTY
IERESGEEKHIDLQGVFVQIGLVPNTDWLADTVERTRMGEIVVDNRGATTVPGVFAAGDC
TNAPFKQIIISMGSGATAALGAFDYMIRNQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggatgcagacatcaaatcacaactggcgcaatatctccagctcttggaaggc
aatgttctgctgaaggtcagtgcaggatccgattcggtatctaacgacatgctggattta
gtgaatgaactatccggcatgtctgataaaattacggtagagcatactacattgcctaga
actccaagctttagcgtaaaccgtgtaggtgaagacactggcgttacatttgctggggta
ccattaggtcatgagttcacttcgttggtgctcgctttgcttcaagttagcggtagaccg
cctaaggttgagcagagcgtcattgatcggattaaggcaattcaaggtgtatatcacttt
gagacttatgtcagcttgtcctgccacaactgtcctgacgttgtacaggcgctgaacatg
atgagcgtgcttaatcctaacattactcacaccatgattgacggtgcagccttcaaggaa
gaagtcgagagcaaggacattatggccgtgccaagtgtctatctcaacgctgaattcttt
gagagtggccgtatgacggtagaggatatcttgaataaaatgggcagctcgaaggatgct
tccgagtttgataataaagagccatacgacgtgttggttgttggtggcggtccagccggc
gcgagcgcagcgatctacgcagcacgcaaaggcattcgcacaggtattattgctgaacgc
ttcggcggacaagtgaatgatacgctgggcatcgagaacctgatcggtacgaaatataca
gaaggtcctaagcttgctgccagccttgaggagcatgcgaaggaatacaacatcgatatc
atgaaatctcaacttgcgaagcgtcttgagaagaaggacttcgttgaggttgaattggag
aacggtgctattctgaagagtaagaccgtaattgtgtctacaggtgctcgttggcgtaac
ctgggtgtacctggcgaagctgagttcaagaacaagggcgtggcttattgcccgcattgc
gacggtcctctgttcgctggtaagcatgttgccgttgttggcggcggtaattctggtatt
gaggcagctattgatctggcaggcgtcgccggccatgttactgtcctcgaattcatgtca
gaattgaaggctgattccgttcttcaagaacgtctgaacagcttgccgaacacaaccgtc
atcaagaacgctcaagtgaaagaaattaccggaaccaataaggttgatggtgtgacttac
atcgagcgtgagagcggtgaagagaagcatattgatctgcaaggggtatttgtccaaatc
gggcttgttccgaatacagattggttagctgacaccgtagaacgtactcgtatgggtgag
atcgtcgtagacaaccgcggcgcaacgaccgttcctggcgtatttgccgcaggcgactgc
acgaacgctccattcaagcagatcatcatttcgatgggctctggtgctactgcagcgctt
ggcgcattcgattatatgatccggaatcaataa

DBGET integrated database retrieval system