KEGG   Paenibacillus larvae: ERIC2_c01060Help
Entry
ERIC2_c01060      CDS       T02963                                 

Gene name
flgL
Definition
(GenBank) flagellar hook-associated protein 3
  KO
K02397  flagellar hook-associated protein 3 FlgL
Organism
plv  Paenibacillus larvae
Pathway
plv02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:plv00001]
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ERIC2_c01060 (flgL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:plv02035]
    ERIC2_c01060 (flgL)
Bacterial motility proteins [BR:plv02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    ERIC2_c01060 (flgL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flagellin_N Flagellin_C DUF2408 Fez1 Spc7 HrpB7 DUF883 Allexi_40kDa DUF4201
Motif
Other DBs
NCBI-ProteinID: AHD03987
UniProt: V9W4B7
LinkDB All DBs
Position
106438..107337
Genome map
AA seq 299 aa AA seqDB search
MSMRITQGMMHSQINRNLNSTLNKLADITMQINTGRKLNKPSDDPIGVTYSVYYRSELTA
NQQYKKNVEDALSWFDFNDKTIGQSTDIMHRLKELATNAASSGGKSPETLNGIKKEVNEL
KDELLNIANSRYNGRYVFNGQKVDQMPYTEKTAASAFTDAGKIIYDIGAGVQIDINYSGG
EIFGNPEDEDQIFKVLEEFSQALENEDYDQVNALRGKLESRFDKMQSVRSEVGAKVNRVE
LTRERLKDLETNLTSLQAKTEDADIIKLIYEEKIQENCYQTSLAVGSKIIMPSLVDFMR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgcgtatcacgcagggaatgatgcattcacaaattaatcgaaacttaaattcg
actttaaacaaactggctgacataaccatgcaaataaataccggacgtaaactgaacaag
ccatcggacgatccgataggggttacatattccgtttattaccgcagtgaacttacggct
aatcaacagtataagaagaacgtcgaagatgctttatcatggtttgattttaacgataaa
actatcggccaatcaacggatattatgcatcgtcttaaagaactggctacaaacgcggca
tcatcggggggaaagtccccggaaacattgaacggtattaaaaaagaagtcaatgaattg
aaggatgagcttttgaatatcgcgaacagccggtacaatggcaggtatgtatttaacgga
caaaaggtggatcaaatgccttacactgaaaaaacggctgcttcagcttttaccgatgcc
ggtaaaattatttacgatataggtgcaggtgttcaaattgatatcaattattcgggtggg
gaaatttttggaaatcctgaagatgaagatcaaatttttaaagtgttggaggaattttcc
caggccctggaaaacgaagattacgatcaggttaacgccctgagaggcaaactggaaagc
cgttttgataaaatgcagtcggtccgttcggaagtaggggctaaggtaaaccgtgtagaa
ctgacccgagaaaggctgaaggatcttgagacaaatttaaccagcctacaggccaagaca
gaagacgccgacattattaaattaatttatgaagaaaagatacaggaaaattgttatcag
acttctttggcagtagggtccaaaatcattatgccttctcttgtggatttcatgaggtga

DBGET integrated database retrieval system