KEGG   Paenibacillus larvae: ERIC2_c01230Help
Entry
ERIC2_c01230      CDS       T02963                                 

Gene name
argJ
Definition
(GenBank) arginine biosynthesis bifunctional protein ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
plv  Paenibacillus larvae
Pathway
plv00220  Arginine biosynthesis
plv01100  Metabolic pathways
plv01110  Biosynthesis of secondary metabolites
plv01130  Biosynthesis of antibiotics
plv01210  2-Oxocarboxylic acid metabolism
plv01230  Biosynthesis of amino acids
Module
plv_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:plv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ERIC2_c01230 (argJ)
Enzymes [BR:plv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     ERIC2_c01230 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     ERIC2_c01230 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AHD04003
UniProt: V9W1M4
LinkDB All DBs
Position
123007..124233
Genome map
AA seq 408 aa AA seqDB search
MQTKQVGFTEVAGGTITTPKGFTAAGLHCGLKQAGRPDLGAIVCEVPAAAAAVYTQNAFQ
AAPLHVTRDSLASGGKLQALLVNSGNANACTGRQGLADAYEMRSAMAEALGVPAALVGVA
STGIIGELLPMEKVRGGIARMPRQLSADGCDFSQAILTTDLVQKSVCVRLEIAGKTVHIA
GTAKGSGMIHPNMATMLGFITTDARIGSGQLQSLLGQTTDSTFNMITVDGDTSTNDMVVV
LASGLAGHDPLHPGHSDWSVFAEAFCYVAQYLAKAIARDGEGAAKLIGVNVRGALSNRSA
GIIAKTVVGSSLVKTACYGADANWGRIIAAVGRSSEPVAADFVDIHIGEIPVLIKSAPVE
VDEEKATLYLKGEEVAIYIDLHQGAGSATAWGCDLTYDYVRINASYRT
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgaaacaagttggctttacagaagttgccggggggacgattaccaccccgaag
ggttttactgccgcaggtttgcactgcgggctcaaacaggccggccgacccgatctcggc
gcgatcgtctgtgaggtgccggccgcagcggctgcggtatacacgcagaacgctttccaa
gcggcacctctgcacgtgacgcgggacagcctcgcgtccggcggcaagcttcaggcgttg
ctcgtgaacagcggcaatgccaatgcctgcaccggccgtcagggactggccgatgcgtat
gagatgcgctccgctatggcggaagcgcttggagtgcccgcggcgctcgtcggcgtcgcg
agtacgggcatcatcggcgagcttctgccgatggagaaggtgcgcggcggcatagcccga
atgccgcggcagttgtcggcggacggctgcgacttcagccaggccatcctgacgacggat
ctggtacagaagtccgtctgcgtccgcctggagattgccggcaagaccgtacatatcgcc
gggacagctaagggctccgggatgatccatccgaacatggcgactatgctcggatttatc
accaccgacgcccgtatcggctcagggcagcttcaatcgctgctggggcaaactaccgat
tccaccttcaatatgatcacggtggatggggataccagtacgaacgatatggtcgtcgta
ctggcaagcggattggcgggtcatgaccctctgcatccgggacatagtgactggtctgtg
tttgctgaagcattctgttatgtggcccaatatttggccaaagcgattgcccgggacggg
gaaggagctgccaagctgatcggggtgaatgtacggggagctttaagcaaccgttcagcg
ggcatcatagccaaaacggtggtgggttccagtcttgtaaagacggcctgctacggggct
gatgccaactgggggcgcattatagcggcggtggggcgctccagtgaaccggtagctgcc
gattttgtggatatccatatcggggagatcccggtactaataaagtcggctcctgttgaa
gtggatgaagagaaagccactctatacttgaagggagaagaagtggcgatttacatcgat
ttgcaccagggtgcaggatcggcaaccgcctggggctgtgatttaacttatgattatgta
cggattaatgcgtcatatcggacttga

DBGET integrated database retrieval system