KEGG   Paenibacillus larvae: ERIC2_c02410Help
Entry
ERIC2_c02410      CDS       T02963                                 

Gene name
hisI
Definition
(GenBank) histidine biosynthesis bifunctional protein HisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
plv  Paenibacillus larvae
Pathway
plv00340  Histidine metabolism
plv01100  Metabolic pathways
plv01110  Biosynthesis of secondary metabolites
plv01230  Biosynthesis of amino acids
Module
plv_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:plv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ERIC2_c02410 (hisI)
Enzymes [BR:plv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     ERIC2_c02410 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     ERIC2_c02410 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: AHD04107
UniProt: V9W4P7
LinkDB All DBs
Position
248724..249452
Genome map
AA seq 242 aa AA seqDB search
MTEANKQQWTELIRFNEQGLVPAIIQDAASKEVLMLGYMNEGSLHKTIESGETWFWSRSQ
KKLWHKGATSGNIQKVTDIAYDCDQDTLLVKVVPAGSACHTGRYSCFQSAGTHGQQASSH
LVSGCPSSAAKENGLLTSFGREGDARFTILSDLESVIAFREAERPEGAYTTYLFEKGLDK
ILKKVGEETAEVIIAAKNQDKDELRYETADLIFHLLVLFRELKLPLDDVMYELEKRHIRV
PK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagcgaataagcagcagtggaccgaacttatacgatttaatgaacaggggctt
gttcctgcgattatacaggatgctgccagtaaggaagtgttgatgctggggtacatgaat
gagggatccctgcataaaacgattgaatcgggagagacctggttctggagccgttcccaa
aaaaaattgtggcacaaaggggcaacatccgggaatatccagaaagttacagatattgcg
tatgactgtgaccaggacaccttgctggtaaaggttgttccggcgggatccgcctgtcat
accggccgttacagctgttttcaatctgcaggaacgcatggtcagcaggcttcttcccat
ttggtgagtggttgtccctcttcagctgccaaagaaaacggtctgcttacatcttttggc
cgggaaggggacgccaggtttaccatcctttctgatttggagtccgttattgctttcagg
gaggcagaacgccctgaaggcgcatatacgacctatttgtttgaaaagggattagacaag
atacttaaaaaggtcggagaagaaacggctgaggtgattattgcggctaagaatcaggac
aaagacgaactccgatatgaaaccgctgatcttatatttcacctgcttgttctgttcagg
gagttaaagcttcctttggatgacgtcatgtatgaattggaaaagcgtcatattcgcgtc
ccgaaataa

DBGET integrated database retrieval system