KEGG   Paenibacillus larvae: ERIC2_c33540Help
Entry
ERIC2_c33540      CDS       T02963                                 

Definition
(GenBank) putative phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
plv  Paenibacillus larvae
Pathway
plv00630  Glyoxylate and dicarboxylate metabolism
plv01100  Metabolic pathways
plv01110  Biosynthesis of secondary metabolites
plv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:plv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ERIC2_c33540
Enzymes [BR:plv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     ERIC2_c33540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AHD07091
UniProt: V9W7T1
LinkDB All DBs
Position
complement(3312753..3313517)
Genome map
AA seq 254 aa AA seqDB search
MAYLLAGDRKVRIEGILFDKDGTLLDFMSLWGEWAQSVCDSLAGYVSSESSISLDDLLGT
VSDDKGNIVSHNPKGPLMMASPEEMGAIIAWRLYYEGHSWNDSLTLARRFFQAADAHVEE
QRGAKPIHGLPEFLGQCRAQGLKLAVVTSDHTASAVKHLEWMNIRDYFEHIIGDDQVKHG
KPHPEMVGEACARLGLVPSQTVMIGDANGDMQMGKRGGVALTVGIASGPEARDALRDADI
IAGHYHELSLSAEL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcatacttgttggcaggtgaccggaaggtcaggattgaaggtattttgttcgataag
gacgggacacttttggattttatgagcttgtggggcgaatgggcccaatccgtgtgcgat
tcactggccggatatgtatcttcagagagttcgatttcgctggatgatttgctgggaacg
gtgagtgatgacaagggaaatattgtctcccataaccccaaagggccgcttatgatggcc
tccccggaagaaatgggggcgattatcgcctggcggttatattatgaaggtcattcctgg
aatgattctctgacgctggcccgccgttttttccaagcggctgatgcgcatgtggaagaa
cagaggggagcgaagccgatacatgggttgcccgaatttctggggcaatgccgtgcacag
gggcttaagcttgctgtcgttacttcggatcatactgcatcggctgtcaaacatttggaa
tggatgaatattcgcgattattttgagcatataatcggagacgatcaagtaaaacacggc
aagccccatcctgaaatggtcggggaggcctgtgcccgcctgggtcttgttccgtcacag
acggttatgattggagacgccaacggggacatgcaaatggggaaacggggaggcgtggca
cttactgtcggaatcgcctccggcccggaagcacgggatgcacttcgtgatgccgatatt
attgcaggccattatcatgaactttctctatcagccgaattataa

DBGET integrated database retrieval system