KEGG   Paenibacillus larvae: ERIC2_c37160Help
Entry
ERIC2_c37160      CDS       T02963                                 

Definition
(GenBank) hypothetical protein
Organism
plv  Paenibacillus larvae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0029 DUF1949
Motif
Other DBs
NCBI-ProteinID: AHD07429
UniProt: V9WC41
LinkDB All DBs
Position
complement(3657180..3657818)
Genome map
AA seq 212 aa AA seqDB search
MIPQYKTVQQENAAEIVIKRSRFIGHAKPVYTEEEAVQFIQKIKKQHAMATHNCSAYMIG
ERNQIQKQSDDGEPSGTAGKPILEVIRNQKMQNIVIVITRYFGGILLGAGGLVRAYTDGA
VAAIEAARPIYRILHQEIRIDLDYTRLGKVQNELRNKGTMLGESLFTDKVSLFCYPLAEE
AEFFMAWMTDLTQGQSVITAGDVMYKDHETLP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgattccacagtataagacagtacaacaagaaaatgcagccgaaatcgtgattaagcgt
tcccgttttatcggtcatgcgaagcccgtttatacggaagaggaagcggtccagtttatt
cagaagattaaaaagcagcatgcaatggctactcataactgctcagcttacatgattggc
gaacgcaatcagattcagaagcaatcagatgacggagaacccagcggaacagccgggaaa
cctatccttgaagtcatccgtaatcaaaaaatgcaaaatatcgttattgtaataacgcgt
tactttggcgggattctgctgggggcaggaggcctggtaagggcttatacggatggggct
gttgccgctattgaagcggccaggccaatttaccggattttacaccaggagatccgtatt
gaccttgattatacgcggctgggcaaagtccagaatgaattaagaaacaaaggaaccatg
ctgggcgaatcactgtttaccgacaaagtaagcctattttgttatccgcttgcagaggag
gcggagtttttcatggcatggatgacggatttgacgcaaggtcaaagtgtgattacggca
ggagatgttatgtataaggatcacgagaccctgccttaa

DBGET integrated database retrieval system