KEGG   Paenibacillus lautus: D5F53_01450Help
Entry
D5F53_01450       CDS       T05701                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
plw  Paenibacillus lautus
Pathway
plw00620  Pyruvate metabolism
plw00680  Methane metabolism
plw01100  Metabolic pathways
plw01120  Microbial metabolism in diverse environments
plw01200  Carbon metabolism
Module
plw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D5F53_01450
  09102 Energy metabolism
   00680 Methane metabolism
    D5F53_01450
Enzymes [BR:plw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D5F53_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 TipAS
Motif
Other DBs
NCBI-ProteinID: AYB42028
UniProt: A0A385TGB6
LinkDB All DBs
Position
291612..294398
Genome map
AA seq 928 aa AA seqDB search
MTELTVTAKSNSNNLLRRDVRFLGNILGEVLVHQGGNELLDIVEKIRETSKSLRSVFLPE
LFADFKRIISTLEPDIRHQVIRAFAIYFQLVNIAEQNHRIRRKRDYERSAGESVQPGSIE
SAVQDLKERNITFEEVQEILESLSLELVMTAHPTEAMRRAILDIHKRIADDVMQLDNPTL
TFREREQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHILPEVYQELER
CLTKYYPGHHWHVPTYLRFGSWIGGDRDGNPSVTADVTWRTLEMQRKLAIREYQRILREF
MKYLSFSSSIVNVSDELLQSIEKDREHVTLKKMEIWHNEKEPYRVKLVYMLAKMSHILDE
NMTGGERYQTPEEFIEDLNIIDRSLRFHFADYVADTYIQKLIRQAELFGFHTATLDIRQH
SQEHENAMAEILRKMNVTQDYAQLSEDEKIELLNNLLNDPRPLTTPYQEYSDSTEECLEV
YRTVFRAQQEFGVKCISSYLISMAEGASDILEVMVFAKEVGLFRKDNDGSVIATLQAAPL
FETIDDLHAAPEIMRKLFSLPIYREAVSAMNELQEIMLGYSDSNKDGGAITANWELQVAL
KEITAVANEYGIKVKYFHGRGGSLGRGGMPLNRSILAQPASTIAGGIKITEQGEVISSRY
SLKGIAYRSLDQATSALITASLNARYPEKESTEKEWEVISSSISAVSQKKYQDLIFRDPD
FLTFFKESTPLPEVGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYAAGTG
LQSFYQGKEENMKVLQQMYTSYPFFTSLIDTLQMALAKADLIIAKEYSLMTKDDQARERI
FGLIQEEFKLTKELVLKITGQQDILDNQPVLQESIRLRNPYVDPLSYLQVQLLNELRELR
EQEQDDPDLLREVLLTINGIAAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacttacagtaaccgcaaaaagcaattccaacaatctgctacggcgagatgta
cggttccttggcaatattcttggagaagttcttgtccatcaaggaggcaatgagctttta
gatatagttgagaaaattcgcgaaacgagtaaatcgttgcgatccgtattcctgccagaa
ttgtttgcagatttcaaaaggatcatcagcacgctggagcccgacattcgccatcaggtg
attcgcgcgtttgccatttactttcaattggttaacatcgccgaacagaatcatcgcata
cggcgtaaacgcgattatgagcgttccgccggggaaagtgttcaaccaggttccatcgaa
agtgcagtccaggatttgaaagagcgcaatattacgtttgaagaagttcaagaaattctc
gaaagtctatcccttgagctggtgatgaccgctcatccaacagaagcgatgcgtcgggct
attctggatatccataaacggatagcggacgatgtgatgcagctggacaatccgacactg
acattccgcgaacgggagcagcttcgggagaaactactgaatgaagtgattacgctatgg
caaaccgatgagcttcgtgaccgtaagcctactgtcctggatgaagtcagaaacggtatg
tattattttcacgaaaccctgtttcacattctgccagaggtttatcaagaactggagcgc
tgcctaactaaatattatccgggtcaccattggcacgttccaacctatttgcgtttcggt
tcgtggatcggtggcgatcgggacggaaatccttcagtgacggcggacgtaacatggaga
acgcttgaaatgcagcggaagctggcgattcgtgaataccaacggattttgcgtgaattc
atgaaatacctgagcttcagctcgtcaatcgtgaacgtttcggatgaattgcttcaatcc
attgaaaaagaccgcgagcatgtaacactgaagaagatggaaatttggcacaatgagaaa
gagccttatcgtgtaaaactggtatatatgctggctaaaatgagtcacattctggacgag
aacatgacaggcggcgagcgttatcagacccctgaggaattcatcgaggatttgaatatc
attgatcgaagcctgcgtttccattttgctgactatgttgcagacacctatattcaaaag
ctgattcgccaggcggagttgtttggtttccataccgcaacgctggatatcagacagcat
agccaagagcatgagaatgccatggccgaaattctgcggaaaatgaacgtgactcaggac
tacgcccaattgagcgaagacgagaagatcgagctgctcaataacttgcttaacgatccg
cgtccattgactacaccttatcaagagtatagcgacagcacggaggaatgcctcgaagta
taccgtaccgttttccgtgcgcagcaggaattcggcgtaaaatgcatctccagttatttg
atcagtatggccgagggcgcaagcgacattctggaagtgatggtatttgccaaagaagtc
gggctgttccggaaggataacgacggttccgtaatcgctacattgcaggctgcgccatta
ttcgagacgattgacgatcttcatgccgcgccggaaatcatgcgcaagctcttcagcctg
ccgatctaccgagaagcggtgagcgccatgaacgaactgcaggagatcatgctgggctac
tctgacagcaacaaggatggcggagccattacggcgaactgggagctccaggtagcactc
aaagagattacggccgtagccaatgaatacggcatcaaggtaaaatacttccatggacgc
ggcggatcgcttggacgcggcggtatgcctctgaaccgcagcattttggctcagccggca
tcgaccattgcaggcggcatcaaaatcacggagcagggcgaggttatttcgtcccgttac
tccttgaagggcattgcctaccgtagtttggatcaggcgacctcggcattgattacggct
tccctgaatgcccgttaccctgagaaagaatcgaccgaaaaagagtgggaagtgatttcc
tccagcatttcggccgtttctcagaaaaaatatcaggatctgatattccgcgatccggat
ttccttaccttcttcaaggaatccacgccgcttcctgaggtgggcgagctgaatattggt
tcccgtccttccaaacgcaagaacagcgaccgttttgaggacctgagagccattccttgg
gtgtttgcatggacgcagagccgttacctgcttccggcatggtacgcggctggtacgggc
ttacagagcttctaccaaggcaaggaagagaacatgaaggtgcttcaacagatgtacaca
agctatccgttttttacgtccctgatcgatacccttcagatggcactcgccaaggcagat
ctgatcatcgccaaggagtattccttgatgacgaaggatgaccaagcacgcgagcgcatc
ttcggtctgattcaggaagaattcaaattgacgaaagaactggttcttaagattacagga
caacaggatattctggataaccagccggttctgcaggaatcgataagactccgcaaccct
tacgtggatccgctcagctacttgcaggttcaactgcttaacgagctgcgtgaactaagg
gagcaggaacaggatgatccggatctgcttcgggaagtactgctgactatcaacggcatt
gccgccggtcttcgcaatacaggctga

DBGET integrated database retrieval system