KEGG   Paenibacillus lautus: D5F53_03665Help
Entry
D5F53_03665       CDS       T05701                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
plw  Paenibacillus lautus
Pathway
plw00473  D-Alanine metabolism
plw01100  Metabolic pathways
plw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D5F53_03665 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    D5F53_03665 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:plw01011]
    D5F53_03665 (alr)
Enzymes [BR:plw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     D5F53_03665 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:plw01011]
 Precursor biosynthesis
  Racemase
   D5F53_03665 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Arteri_nsp7a PAAR_motif
Motif
Other DBs
NCBI-ProteinID: AYB42431
UniProt: A0A385TG73
LinkDB All DBs
Position
739437..740624
Genome map
AA seq 395 aa AA seqDB search
MQAIYRPTLAEINLDHLRANYNAFREALPDHMKLLACVKANAYGHGAVEVARELQRLGAA
YLSVAFLDEALELRQGGISGPILVLGYTPPEAVEIAYAYDVTITLFSSEVLQAIKALPVK
PEKPLKVHIKIDSGMGRLGLLPGEDAISFIEEAFSLPQVVVEGMFTHFARADEENKDYTL
GQYRRFQGVADALRDKDYHIPIIHTGNSAAAIDTPELSYNMVRVGIGLYGLYPSDEVNRK
TVSLRPVMTLKTKLVYVKNLPPHSGISYGTKYVTEQEERIGTLPIGYADGFSRMLSGKAE
VLIRGRRVPVVGNICMDQCMVSLKSFAEEAEQIKAGEEVVLIGQQSGECITADELAAKLG
TIHYEVVCMIAHRVPRLYIRDDIPVKTVNALWNNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgcaagcgatatatcgacctaccctggcggaaatcaacctggaccatctgcgcgccaac
tataacgcttttcgtgaggcgctgccggatcacatgaaattgcttgcttgtgtgaaggcg
aacgcttatggtcacggagccgtagaagtggcacgcgaacttcagcgactgggtgcggca
tacttaagcgtggctttccttgatgaagcgcttgagcttcggcaaggcggcatctctggc
ccgatcctggtgctcggttataccccaccggaggctgtagagatcgcttacgcgtatgat
gtaaccataaccctgttcagttcggaagtgctccaagcgataaaggcactgccggtcaaa
ccggagaagccgcttaaggtacacatcaagattgacagcggaatgggtcgtttgggcctg
cttcccggcgaagatgcgatttcttttatagaagaagcgttttcgctgccgcaggttgtg
gtcgaaggaatgtttacccattttgcaagagcggatgaagagaacaaagactatacattg
ggacagtatcgccgtttccagggcgttgcggacgctcttcgggataaggattaccatatc
ccgatcatacatacgggcaacagcgctgctgcgatcgatacacctgagctatcctataat
atggttcgcgtcggcatcggcttgtacggactatatccttcggacgaggtgaatcgaaag
acagtgagcctccgccctgtcatgacgctaaagacaaagcttgtctacgtcaaaaattta
cctccgcattccggcatcagctatgggacgaagtatgtaacggagcaggaagaacgaatt
ggaacccttcccatcggttatgccgatggcttctctcgtatgctgagcggcaaagcggaa
gtgctgatacgcggccgccgcgtccctgtagtcggaaatatctgtatggaccaatgtatg
gtatcgctcaaatctttcgccgaggaggcggaacaaatcaaagctggtgaagaggttgta
ctcatcggccagcaatctggcgaatgcatcacggcagatgagctggcagccaagctgggg
acgatccactatgaggtcgtctgcatgattgcccaccgggtaccgcgcctgtatatacgc
gatgatataccggtaaagaccgtaaacgcgctttggaacaacctttaa

DBGET integrated database retrieval system