KEGG   Paenibacillus lautus: D5F53_04355Help
Entry
D5F53_04355       CDS       T05701                                 

Definition
(GenBank) hypothetical protein
Organism
plw  Paenibacillus lautus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rho_Binding DUF5566
Motif
Other DBs
NCBI-ProteinID: AYB42558
UniProt: A0A385THW0
LinkDB All DBs
Position
880458..882455
Genome map
AA seq 665 aa AA seqDB search
MTTSDRKSVTVDIYGTSYKLVGNSSDYTRQVANYVDDRMRTISKAHSRLDTPRIAVLAAV
HMAEEALQKLEYQNEAKQMTAERNELRTELAKVQGLQIEQQERHRQQLEQLERKLAEQTT
LAEEYRKSKENLTAESERTKELLQKESDRVAELLKEKQQLEVRLKEQREKLESGHKQAME
DMKRRYEGQISQSALTHKQTVEKLEQSLRTSAKQAEEKLAEQLKKQESTYKQEALLKEQQ
HSKTVQDLKQQHSKTVQDMEQKYTKTVQDLKLEQSKTLQDLEQQQSKTVQDLEKQLSEQR
NRGGQLQTRLSSAEKELNAVKAESDKLKEELHSSKQLAEASSQELRSFRTKAEGLAKELE
ALKQESGKSEEERRRLQKLVVDANQTSRKQQEELQRLSSELQSWRTLADQRKEETGELEM
RIVELMELNESLEEGMKGLQDEIHVMKDEADRILSERRSAQEELKVLQLRNEELEKLTQD
AGIREEETGKLYAMLEEEYDTVSNQLDELRKKATASEERASELAEQLRESEERAVQWQDQ
YQQWVAEREQLAADSEKLASERDEWKRTKLALEEELQSWQQEIASARQVCERLEGEKSEA
AQQYSELGEQYELVMHQYRLLQAEQELKAEQAAQLEEEHRKLKEEYAKLQVEYNEWIELI
EQDQR
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ttgactacatctgaccgtaaaagcgttaccgtagacatctacggaacttcctataaactc
gttggaaacagcagtgattataccagacaggtagccaattacgtggatgatcgcatgcga
accatctccaaggcgcactcccgattggataccccgcgcattgccgtccttgccgcggta
catatggctgaagaagctttgcagaagctggagtatcagaacgaggccaagcagatgacg
gccgagcggaatgagctgcgtacggagctggccaaggtgcagggccttcaaatcgagcag
caggagagacatcgtcagcagctggagcagctggagcgcaagctggcggagcagacaacg
ctggctgaggaatacaggaaatccaaggagaacctgacggcggagtcggagcgtacgaag
gagctgcttcagaaagaatcagaccgggtggcggaacttctgaaggagaagcagcagctt
gaggtgcgtcttaaagagcagcgcgagaagctggagagcggccacaagcaggcgatggaa
gatatgaaacgccgttatgaagggcaaatttcgcagtcggcgctcacgcataagcagact
gtcgagaagctggaacagagtttgcggacttctgcgaagcaggctgaagagaagctggct
gagcagttgaagaaacaggagagcacttataaacaagaggcgctcctgaaagaacagcag
cactcgaagaccgttcaggatctgaagcagcagcactcgaagacggtgcaggatatggag
cagaagtacacaaagaccgtgcaggatctgaagctggagcaatcgaagaccttgcaggat
ttggaacagcagcaatcgaagaccgtgcaggatctggagaagcagctttccgagcagcgc
aatcgcggcgggcagctgcagacgcggttgtcgtccgcggagaaggaactgaacgcggta
aaagcggaatcggacaagctgaaggaagaactccattcgtccaagcagcttgccgaagct
tcctcgcaggaattgcgttccttccgtacgaaggcggaagggctggcgaaggaactcgag
gccctgaagcaggaatccggcaagtcggaggaagaacgtcgacgtctgcagaagcttgtg
gtggatgcgaatcagacctcccgcaagcagcaggaggagctgcagcgtcttagcagcgag
ctgcaatcctggcggacgcttgccgatcagcgcaaggaggagaccggcgagctcgagatg
agaatcgtcgagctgatggaattgaacgaaagcctggaagagggaatgaagggacttcag
gatgagatccatgtcatgaaggacgaagcagaccggatcctttcggagcgccgaagcgcc
caggaggaattgaaggtgctccagcttcgcaacgaagagctggagaagctcacccaggac
gcgggaatccgcgaggaagagaccggcaaactctacgccatgctggaagaagaatacgat
acggtgtcgaatcagctcgatgagcttcgcaagaaggcgaccgccagcgaagagcgtgca
agcgaacttgccgagcagctgagggagtccgaggagcgcgccgttcaatggcaggaccaa
taccagcaatgggtggcggaacgggaacagctggctgcagacagcgagaagctggcctca
gagcgcgatgagtggaaacgaaccaagcttgcgctggaagaagagcttcagtcctggcag
caggagattgcatccgcgcgtcaggtctgcgagcgcctggaaggcgagaaaagcgaagcg
gcacagcagtattccgagcttggcgaacagtacgagctggtcatgcaccagtatcggctg
ctgcaggcagaacaggaattgaaggcggagcaagccgcgcagcttgaggaagaacatcgc
aagctgaaggaagagtatgcgaagctccaagttgaatataatgaatggatcgagttgatt
gagcaggatcagcgttag

DBGET integrated database retrieval system