KEGG   Paenibacillus lautus: D5F53_08815Help
Entry
D5F53_08815       CDS       T05701                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
plw  Paenibacillus lautus
Pathway
plw00564  Glycerophospholipid metabolism
plw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D5F53_08815
Enzymes [BR:plw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D5F53_08815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 FAD_binding_3 Pyr_redox_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AYB43376
UniProt: A0A385TI91
LinkDB All DBs
Position
1862275..1864005
Genome map
AA seq 576 aa AA seqDB search
MEQSQSFSSLDRGHRFQRIAEDTYDLIVIGGGITGAGIALDAVTRGMSVLLVEMQDFAAG
TSSRSTKLVHGGLRYLKQFEVGMVAEVGKERAVVYENGPHVTTPEWMLLPIHQGGTFGKF
STSIGLMVYDFLAGVKRGERRSMLSASETLKREPLLKQEGLKGGGYYVEYRTDDARLTLE
VMKEAAARGAVLFNYAKAESLNYDANGRITGVTVRDMLGGGVKSVSGTKIVNAAGPWVDQ
VREMDRSRKGKMLQLTKGVHLVIDQSRFPLRQAVYFDTPDGRMVFAIPRDGKTYVGTTDT
VYKADPVRPLITVEDRDYILKAIHYMFPGVKLSPADVESGWAGVRPLILEEGKSPSEISR
KDEIWESPSGLITIAGGKLTGYRKMADTVVDLVAKRIQESGGKAYGASVTKNLPISGGQV
GGSSQFPDFVRKQTEIGAAQGIDRKLAEHWARMYGSNAAELFRLAKEGSDQAEASALPVS
VLVPLMYAIEHEMASKPADFFIRRTGSLLFHIDWTRKWKVPVIHYMATVLGWSEQQKTEY
TRELDEELASAAQPAANESPAQAPTPKNVSKAKLSS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtggagcagtcacagtcgttttcaagtttggaccgcgggcatcgatttcaaagaatagca
gaggacacctacgatctgatcgtgatcggcggcggaatcaccggtgccgggattgcactg
gatgcggtcacgcgcggcatgtcggtgctgctggtggaaatgcaggattttgcggcggga
acgagcagccgttccaccaagctggtgcatggcgggctgcggtatttgaagcagtttgaa
gtcggcatggtggccgaggtaggcaaagaacgggccgtggtgtacgagaacgggccgcac
gtaacgaccccggagtggatgctgctgccgatacaccagggcggcaccttcgggaagttt
agtacctccatcggtttgatggtgtatgacttcctggccggcgtgaagcggggagaacgg
cggtccatgctgtccgcatccgagacgttaaagcgggagccgctgctgaagcaagagggc
ctgaagggcggcggctattacgtggaataccggacggacgacgccaggctgacgctggag
gtcatgaaggaggcggccgccagaggggcggttctgtttaactacgccaaggcggaatcg
ctgaattatgatgcgaatgggcggattaccggggttacggtaagggatatgctcggcggc
ggggtgaagtccgtctccggcaccaaaatcgtaaatgcggccggaccttgggtggatcaa
gtgcgcgaaatggataggtccaggaagggaaaaatgcttcagctgaccaaaggggttcat
ctggtcatcgaccagtccaggttcccgcttcgccaggcggtctacttcgatacgcccgac
ggcaggatggtgtttgccattccccgggacgggaaaacctatgtcggcacaaccgacacg
gtttataaggcggatcccgtacgtcccttgatcacggtggaagaccgggattatattttg
aaggccatccattatatgtttccgggcgtaaagctaagtccggcagacgttgaatcggga
tgggccggagtccgtcccctgattctggaggaaggcaagagcccgtccgaaatttcccgc
aaggatgaaatttgggaatccccctccggcctgatcaccattgccggaggcaagctgacc
gggtatcggaaaatggcggacaccgtcgtcgacctggtagcgaaacggattcaagagagc
ggcgggaaggcatatggcgccagcgtaacgaagaatctgccgatttccggcggtcaggtt
ggcggttcgagccaattcccggattttgtccgcaagcagacggagatcggcgcggcgcaa
ggaattgaccgtaagcttgccgagcactgggcgcgaatgtacggctcgaacgcagcggaa
ttgttccgcttggccaaggaaggctccgatcaggcggaggcatcggcgcttccggtgtcg
gtattggttccgctgatgtatgccattgagcatgagatggcatcgaagccggccgacttt
tttatccgtcgcacggggtctctcttgtttcatatcgactggacgagaaaatggaaggtg
cccgtgatccattatatggctaccgtactgggctggagcgagcagcagaaaaccgagtac
accagggaactggatgaggagctggcttcggccgcgcagccggccgctaacgaatcgccg
gcccaggctccgactccgaagaacgtttcaaaggccaaactttcgtcttaa

DBGET integrated database retrieval system