KEGG   Paenibacillus lautus: D5F53_18615Help
Entry
D5F53_18615       CDS       T05701                                 

Gene name
trpE
Definition
(GenBank) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
plw  Paenibacillus lautus
Pathway
plw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plw01100  Metabolic pathways
plw01110  Biosynthesis of secondary metabolites
plw01130  Biosynthesis of antibiotics
plw01230  Biosynthesis of amino acids
plw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    D5F53_18615 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    D5F53_18615 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D5F53_18615 (trpE)
Enzymes [BR:plw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     D5F53_18615 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-ProteinID: AYB45173
UniProt: A0A385TNF8
LinkDB All DBs
Position
complement(4066760..4068313)
Genome map
AA seq 517 aa AA seqDB search
MANPSMEQVVAMAGEYNLIPVAIRLLADMETPIRIFQRYAERKRAFLLESVEGGVQWARY
SFIGTDPFLMITGKKGKIEIEKNGERSLLEGKPVEELKALLRTYRSPQLKEMPPFTGGAI
GFFGYDLLQYYEKLPAHAMDDLGMDDIRFMFCDQVIVFDHVKQQIMLVGNVHVKPGDSDD
TIRQTYMEVCRGLEAAAEQLQDQGPRENVNSRGIPADVDMGDIKSNMTKEKYLSNVEQAK
EYIRAGDIFQVVLSQRFHIETEVSPLHVYRVLRTLNPSPYMYYLKMDDDIIVGTSPEALV
KVDGRRLETRPIAGTRPRGSDEAEDQALADDLLQDEKERAEHLMLVDLGRNDLGRVSEFG
TVKCDTFMEIEKYSHVMHMVSSVSGQLSENKDFFDAFLSCLPAGTVSGAPKLRAMEIIAE
LEREARGAYAGAIGYLGFGGNMDSCITIRTIIFRQGKAYVQAGAGIVWDSVPEKEYEETV
NKAKGMLKAIRVAEAMFPSSTGANDLINQDYLYQYTP
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatccatcaatggagcaagtggtggcaatggcaggtgaatacaacctgattccg
gtagcgatcagactgttagccgatatggaaaccccgattcgcatttttcagcggtatgcg
gagcggaagcgggcatttttactagagagcgttgagggcggcgtacagtgggcacggtat
tcgttcatcggaacagaccccttcttaatgataacgggtaaaaaaggcaagattgaaatt
gaaaagaacggggagcgctccttgctggaaggcaagcccgtcgaggagcttaaagcgctg
ctgcgaacgtatcgcagtccgcagctgaaggagatgcctccttttaccggaggggccatc
ggatttttcggatatgatctgcttcaatattacgagaagctgccggcacacgcgatggac
gatctcgggatggatgatatccggttcatgttttgcgaccaagtcattgtcttcgaccac
gtgaagcagcagatcatgctggtcgggaacgtgcacgtgaaacctggagattcggacgat
accatccgtcagacctacatggaggtatgccgtggcctggaagcggcggccgagcagctg
caggatcagggaccgcgggagaacgtgaactccagaggcatcccggccgatgtcgacatg
ggcgacattaaatccaacatgaccaaagagaagtacctctccaatgtggagcaagcgaag
gaatatattcgtgcaggcgacatttttcaagttgtgttgtcccaacgcttccatatcgaa
accgaagtatcgccgcttcacgtctaccgggtgctgagaacgctgaatccttcgccgtac
atgtattatctcaaaatggacgacgacattatcgtgggaacctctcctgaagccttggtg
aaggtggatggacgaaggctggaaacaagaccgatcgcaggcacaaggccaaggggcagc
gacgaagccgaagaccaggcgctggcggatgatctgctgcaggacgagaaggagcgcgcg
gagcatttgatgctggtggatctgggccgcaacgatctgggccgcgtatcggagttcggt
acggtgaaatgcgatacgttcatggagattgaaaaatactcccacgtgatgcatatggta
tccagcgtatccggccagttgagtgagaataaggatttctttgatgcttttctgtcctgt
ttgccggcgggaacggtatccggagctccgaaactgcgggcaatggagatcattgccgaa
ttggagcgggaagcgagaggcgcatatgccggggctatcggttatctgggctttggaggc
aatatggattcctgcattacgatccgcacgatcatttttcgccagggcaaagcttatgtt
caggcaggggccggaatcgtatgggactcggttcccgagaaggagtatgaggaaaccgtt
aataaagccaaagggatgctgaaggcgatccgcgtcgcggaagcgatgtttccgtccagc
acgggggccaacgacttaatcaatcaggattatctgtatcaatatacaccttaa

DBGET integrated database retrieval system