KEGG   Paenibacillus lautus: D5F53_21805Help
Entry
D5F53_21805       CDS       T05701                                 

Gene name
secD
Definition
(GenBank) protein translocase subunit SecD
  KO
K12257  SecD/SecF fusion protein
Organism
plw  Paenibacillus lautus
Pathway
plw02024  Quorum sensing
plw03060  Protein export
plw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plw00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    D5F53_21805 (secD)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    D5F53_21805 (secD)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D5F53_21805 (secD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plw02044]
    D5F53_21805 (secD)
Secretion system [BR:plw02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   D5F53_21805 (secD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF MMPL ACR_tran
Motif
Other DBs
NCBI-ProteinID: AYB45771
UniProt: A0A2A5LP09
LinkDB All DBs
Position
complement(4756966..4758216)
Genome map
AA seq 416 aa AA seqDB search
MKRIISFVGTVLVITILMAVTTPGLLKDVRLGLDLKGGFEILYEAEPLMEGQQVTKEALQ
ETAKSLQKRADAMGTSEPEVTPEGANRIRLKVAGVTDEAEVRKTMKEPANLTFRSNDGCK
EGEEFCKIELRGDDFVENGASVAYDQLNQPMIDIKVKDKGKFAEITERLLGQELAIFMDD
QLLSAPTVRAVLTDGTAQITGNYSLDEAKQIRDTINLGALPLKLVEKYSQSVGATLGMQS
LTKTLEAGLIASVAILLFMIIRYRVPGLLASFALILHTWLLILIFVWADFTLTLPGIAAF
ILGIGMAVDANIITYERIREEIKTGKSVPSAVKSGGKSSLRAIMDSNLTTILVAAVMFGF
GTGAVKGFALVLILEIIVSIATNVYFSRFLLNLLVNIGWARKPSHYGVKERDIREL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaattatcagtttcgtcggaaccgtgctcgtgatcactattttaatggccgtt
acaactccaggcttgctgaaagacgtccgtctaggtttggatctaaagggtggattcgaa
atcctttatgaagcagaaccgttgatggaagggcagcaggttaccaaagaagcgctccag
gaaaccgcaaagagcttgcaaaagcgtgcggatgcgatgggaacatcggagcctgaggtt
acgccggaaggggcgaaccggattcgcttgaaagtggcgggcgtaacggatgaggccgaa
gttcgaaaaacaatgaaagaacctgcgaacctcacattccgaagcaatgacggctgtaaa
gaaggcgaggagttctgtaaaatagagctccgcggcgacgatttcgtcgagaacggcgca
tcggtagcctatgaccagcttaaccagcctatgatagatattaaagtgaaggacaaaggg
aagtttgctgaaattacagaacgtcttctcggtcaagagctggctatcttcatggacgac
caattgctgtcagctccgacggtacgagccgtattaacggacggtaccgcgcaaattacg
gggaactactcgctggacgaggcgaagcagatccgggatacgatcaatctcggcgccctg
cctctgaaactggtcgagaaatattcgcaaagcgtaggggctacgcttggcatgcaatct
cttacaaaaactttagaagccggtctgatcgcttccgtcgcgattttgctgttcatgatt
atccgatatcgcgtaccgggcttgcttgcaagtttcgcacttattttgcatacatggctg
ctgatccttattttcgtatgggctgactttacgttgacgcttccaggtattgcggcattt
atattgggtattggtatggcggtggatgcgaacattatcacctatgaacgcattcgggaa
gagatcaagacaggcaaaagcgtgccatctgcagtgaaatcaggcggtaaatcctccctg
cgcgccattatggactccaacttgacgacgattctcgttgccgcagtcatgttcggattc
ggtaccggtgcagtaaaaggttttgcccttgtattgattttggagatcatcgttagtatt
gccacgaacgtttatttctcccgtttcctgctcaatctgcttgtgaatattggttgggcc
cgcaaaccgagccattatggcgtaaaggagcgtgacattcgtgagctttaa

DBGET integrated database retrieval system