KEGG   Paenibacillus lautus: D5F53_31495Help
Entry
D5F53_31495       CDS       T05701                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
plw  Paenibacillus lautus
Pathway
plw00500  Starch and sucrose metabolism
plw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D5F53_31495
Enzymes [BR:plw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     D5F53_31495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AYB47554
UniProt: A0A385TXA7
LinkDB All DBs
Position
complement(6965078..6966547)
Genome map
AA seq 489 aa AA seqDB search
MQRNHTIMQFFEWHVAADGSHWNRLKNAAPELSKAGIDAVWIPPVTKASSAEDNGYGVYD
LYDLGEFDQKGTVRTKYGTKQELTDAIAACQKNGIAVYVDLVMNHKAGADETERFRVVQV
DEMDRTKDISKPFEIEGWTKFTFPGRGNQYSAFQWNFTHFNGTDYDEINKRSGIYRIVGE
NKSWSDKVDNEFGNYDYLMFANIDYSHPDVRKEMIAWGKWLVDTLQCSGFRLDAIKHINH
DFIKEFAAAMKKKRGDDFYIVGEFWNPELQDCRNFLDTVDYKIDLFDVSLHYKLQAASKA
GRSFDLRTIFDDTLVQSHPMNAVTFVDNHDSQPQESLESWVEDWFKQSAYALILLRKDGY
PSVFYGDYYGIGGENPIPGKREAIDPLLYARANRAYGEQDDYFDHPNTIGWVRRGIPEIE
CSGCAVVIANGETGDKRMFVGEHRAGEVWVDLTRTRKDRVTIGEDGFGLFPVNGGSVSVW
AHPDSPVEA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaaatcatacgattatgcaattcttcgaatggcatgtggcagccgacggctcc
cactggaaccgactcaagaacgcagcgccggagctgagcaaggcagggatcgacgcggtt
tggattcctccggtgacaaaggcatcgtccgccgaggacaatggttacggcgtttacgac
ctgtatgatctgggagaattcgatcagaagggaacggttcgcacgaagtacggaaccaag
caggaattgaccgatgccatcgcggcctgccagaagaacgggatcgcggtctatgtggat
ctggtgatgaaccataaggcgggcgccgatgagaccgagcgtttccgggtggtacaggtc
gacgagatggatcggaccaaggatatatcgaagccgttcgagatcgagggatggaccaaa
ttcacattccccggccgggggaatcaatactctgccttccaatggaacttcactcatttc
aacgggaccgattacgacgaaatcaacaaacgttccggcatttaccgcatcgtcggcgag
aataaatcgtggagcgacaaggtggataatgaattcggcaattacgactacctgatgttt
gccaacattgattacagccatccggatgtgcgcaaggaaatgattgcatggggaaaatgg
ctggtggatacgctgcaatgcagcggattccggctggatgcgatcaagcacatcaatcat
gacttcatcaaagaatttgcggccgccatgaaaaaaaagcgcggcgatgatttttacatc
gtgggagagttctggaaccccgagcttcaggactgccgtaatttcctggatacggtggat
tataaaatcgatctgttcgacgtgtctcttcactataaactccaagcggcttcgaaagcc
ggccgctccttcgatctgcggacgattttcgacgatacgctcgtgcaatcgcatccgatg
aatgccgtcacgtttgtggacaatcacgactcgcagccgcaggaatcgctggaatcctgg
gtggaggattggttcaagcagagcgcttatgcgttgatcctgctgcggaaggacggttat
ccttcggtcttctacggcgattattacggaatcggcggcgagaaccccattcccggcaaa
cgggaagcgattgatccgctgttgtatgccagggcgaatcgggcgtacggcgagcaggat
gattattttgaccacccgaatacgataggctgggtccgccgcggcattccggaaatcgaa
tgttccggctgcgcggtggtcatcgccaacggcgaaaccggggataaacgaatgtttgtc
ggcgagcatcgcgccggagaggtatgggtggatctgacccgcacccggaaggatcgcgta
acgatcggcgaggacggcttcgggctgttcccggtgaacggcggcagcgtgtccgtctgg
gcccacccggatagccccgtggaagcgtga

DBGET integrated database retrieval system