KEGG   Planococcus sp. MB-3u-03: CW734_06370Help
Entry
CW734_06370       CDS       T05387                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
plx  Planococcus sp. MB-3u-03
Pathway
plx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:plx00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CW734_06370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:plx02000]
    CW734_06370
Transporters [BR:plx02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    CW734_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N TniB
Motif
Other DBs
NCBI-ProteinID: AUD13383
LinkDB All DBs
Position
1040259..1041278
Genome map
AA seq 339 aa AA seqDB search
MDERKTILDVKGLRTSFFTDDGEVPAVDNVDFHIRQGEVLGIVGESGCGKSVTSLSIMGL
VPSPPGKIVSGEILFQDKDLTKLSDKEMRQIRGDDIAMIFQEPMTSLNPLFTIGNQLREA
LKIHKKDWSKSQIQERAVEMMKLVGLPRAEALLNDYPHQLSGGMRQRVMIAMALLCDPKV
LIADEPTTALDVTIQAQILKLIKNLNERLDTAVLLITHDLGVVAETCERVVVMYAGKVVE
EGPVHTIFNDPQHPYTRGLLESVPDMRFKKERLYSIPGNVPKPGSIKVGCKYAARCEFAF
DRCRVEDPALYQTAEDHKTRCFLFDPKEAESHDRTVVES
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacgtaaaaccatcttggatgtgaaagggctgcgcacttcctttttcactgat
gatggagaagtaccggcagtcgacaacgtggatttccatatccgccagggggaagtgctc
ggcattgtaggggaatcaggctgcggcaaaagtgttacctcattgtccataatggggctg
gtgccaagtcctccagggaagattgtgagcggggaaattttattccaagataaggatttg
acaaaactatccgataaagaaatgcgccagattcgcggcgacgatatagcgatgattttc
caggagccgatgacttcactgaacccattgtttaccatcggcaatcaattgcgcgaagcg
ttgaagatccacaaaaaggattggtcgaaaagccaaatccaggaacgcgccgtcgaaatg
atgaaactggtcggcctgccacgcgcagaagctttgcttaatgattatcctcaccaatta
tcgggaggcatgcgccagcgcgtcatgatcgcgatggctttgctgtgcgacccgaaagtg
ctgatcgctgacgagccgaccacggcacttgatgtgacgatccaagcgcagatccttaaa
ttgatcaagaatttaaacgaacggctcgataccgctgtcttgctgatcactcatgacctt
ggggtcgtcgctgaaacatgcgaacgcgtcgtcgtcatgtacgcagggaaagtggtcgaa
gaagggccagtacataccattttcaatgatccccagcatccatatacccgcggccttctg
gaaagcgtgcccgatatgcgcttcaagaaagagcggctatactctattccaggaaacgtg
ccaaaaccgggatcgatcaaagtaggctgcaaatacgcagcacgttgtgaatttgccttc
gatcgctgccgcgtggaagacccggcattataccagacggcagaagaccacaagacgcgc
tgtttcctattcgatccaaaggaggccgagtcgcatgacagaaccgttgttgaaagttga

DBGET integrated database retrieval system