KEGG   Planococcus sp. MB-3u-03: CW734_09055Help
Entry
CW734_09055       CDS       T05387                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
plx  Planococcus sp. MB-3u-03
Brite
Enzymes [BR:plx01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CW734_09055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AUD13765
LinkDB All DBs
Position
1556860..1557468
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYVTNVNAALEGHDDLSSKSIEELISD
LNAVPEDIRTAVRNNGGGHANHSLFWQLLSPNGGGQPTGAVADAINNKFGSFDEFKEKFE
AAGKTRFGSGWAWLVVSNGELEVTSTPNQDSPLSEGNTPMLGVDVWEHAYYLKYQNRRPD
YLAAFWNVVNWDEVSKRYEATK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaactaccggaactaccttacgcgtacgatgcgctagaaccgcacatcgac
aaagaaacaatgaacatccaccacacgaaacaccacaacacgtacgtaacaaacgtaaat
gcggccttggaaggtcatgacgatctttcttcaaaatcaatcgaagaattgatttctgac
ttgaacgcagtgccggaagatatccgcacagctgtccgcaacaacggcggcggccacgcg
aaccactcgctattctggcagcttctttccccgaacggtggaggacagccgactggtgca
gtagctgacgcgatcaacaacaaattcggaagctttgacgagttcaaagaaaaattcgaa
gctgcaggtaaaacacgcttcggttctggctgggcttggctagtcgtttctaacggcgag
ctcgaagtcacgtcaacgccaaaccaagattctcctctatctgaaggaaacacgccgatg
cttggagtagacgtttgggaacacgcatactacttgaaataccagaaccgccgcccggac
tatttggcagcattctggaacgttgtcaactgggacgaagtgtccaagcgctacgaagct
actaaataa

DBGET integrated database retrieval system