KEGG   Planococcus sp. MB-3u-03: CW734_11440Help
Entry
CW734_11440       CDS       T05387                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
plx  Planococcus sp. MB-3u-03
Brite
KEGG Orthology (KO) [BR:plx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:plx01001]
    CW734_11440
Enzymes [BR:plx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CW734_11440
Protein kinases [BR:plx01001]
 Serine/threonine kinases: Other
  Bacterial family
   CW734_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Kdo Seadorna_VP7 Pkinase_fungal Haspin_kinase FTA2 YrbL-PhoP_reg DUF1356
Motif
Other DBs
NCBI-ProteinID: AUD14128
LinkDB All DBs
Position
complement(2020549..2022525)
Genome map
AA seq 658 aa AA seqDB search
MLVGKRINGRYKVLEAIGSGGMSNVYLAHDMILDRDVAIKVLRYDFNNEEELRRRFKREA
LSSTSLGHPNIVSIFDVGEDNDLPYLVMEYVPGDTLKEYIIKHSPVEPERAVEIMKQLAS
ALAHAHHNHIVHRDIKPQNVLVDEDGNVKISDFGIAMALSATSYTQTNSVLGTVHYLSPE
QARGGTANKKSDIYSLGIVMYELLTGKLPFSGESAVAIALKHLQTETPSLKETVPDLPQS
LENIVLKATAKNPQYRYASADEMAEDLSTALTPERINEPKFAVPVDEGETRAMPAIKDSG
TYEQADATKTMALPVQEDKKAPKKPADKKKRKKTPIVLAIIAALVLIGLILVFAFPELFQ
PRQVAVPDVSGMEREAAHEELTAAGFVVAEESEQFSEEVDENHVIRTIPEAGKMRDPESS
ISLFISMGKETAEFGDYVGDSLDQAQRMLEDSNYASVDSREEFSDEAPGTILSQSPEAGS
EVVISETAVEFVVSKGPDMREVEDLSGYGEAELNEYARSSGFNIRIVREEESDSVEAGLV
LSQNVAGGEMLEVGSTIEVVLSSGSAELPVNTYVETVEIPYEPAEPAEEGEDPVEQTIRV
YIQDQNQTMVEPVEEFTITETTEHQIEMQIVEGGSASYRIVRDATIILEETVDYENAD
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgttagttggaaaacgaatcaacggccgctataaggtgctagaagcgatcggcagcgga
ggcatgtccaatgtttatttggcgcatgatatgatccttgaccgcgacgtcgccatcaaa
gtgctgcgctacgacttcaacaatgaagaggaattgcgccgccgctttaaacgggaagcg
ctgtcttcgacaagtcttggccacccgaacatcgtcagtatttttgatgtcggggaagac
aatgacttgccgtatctcgtcatggagtatgtacctggagatacgttgaaagaatacatc
atcaagcattcaccggttgaaccggaacgcgctgtggaaatcatgaagcaattggcatct
gcccttgcgcatgcccaccataatcatattgtccaccgggatatcaagccgcaaaacgtg
ctggtggacgaagacggcaacgtcaaaatttcggattttggcattgccatggcattgagt
gccacttcctacacacagaccaactcggtgctcgggactgttcattacttgtctcccgaa
caggcgagaggcggcaccgccaataagaaatccgatatttattcgctcggcatcgtcatg
tatgaattgttgactggaaagctgccgttttcaggtgaatcagctgtggctatcgccttg
aagcatctgcaaacggaaacgccttcattgaaagaaactgtaccggacctgccgcaaagc
cttgaaaatatcgtattgaaagcgactgccaaaaatccacaataccgctatgcctcagca
gatgaaatggcagaagacctttcgacggcgctcactccggaacgaatcaacgaaccgaaa
tttgctgtgccggtagacgaaggggaaacccgtgccatgccggcgattaaagattcgggc
acatatgaacaggccgatgcgaccaaaacgatggcgctgccggtccaagaagataaaaaa
gcgccgaaaaaaccagctgacaagaaaaaacgcaagaagacaccgattgtcctggcgatt
attgcagctttggtattgattggcttaatcctggtattcgcctttcccgaattgttccag
ccgcggcaagtcgccgtgccggatgtttccggaatggaacgggaagcggcacatgaagaa
ctgaccgctgccggctttgtcgttgctgaagaatccgaacaattctctgaagaagtcgat
gagaaccatgtaatccgcaccattcctgaagccggaaaaatgcgcgatccggagtcgagc
atcagcttatttattagcatgggcaaagaaacggctgagttcggcgattatgtcggcgat
tcgcttgaccaggcacagcgtatgctcgaagattcgaattatgcttcagtcgattcacgg
gaagaattttccgatgaagcgcccggcacgatcttgagccaaagccctgaagcgggaagt
gaagtcgtcatcagtgaaaccgctgtcgaattcgtcgtcagcaaagggccggacatgcgc
gaagtggaagatttgagcggctacggtgaagcggaattaaatgaatacgcccgttcttca
ggtttcaatatccgcatcgtccgtgaagaagaatccgattccgtggaagcggggttggtg
ctgtcacagaacgttgcgggaggagagatgctcgaagtcggaagcacgattgaagtcgtg
ttgtcttctggcagtgcggaacttccggtgaatacctatgtcgaaacggtggaaatccct
tatgagccggcagagcctgcagaagaaggtgaagacccggtcgaacagacaatccgcgtc
tatatccaggaccagaaccaaaccatggtcgaacccgtcgaggaattcaccattacggag
acgactgaacaccagattgaaatgcagattgtcgaaggcggcagtgcttcttaccgaatc
gtcagggatgccacgatcattctggaagagacagtggactatgagaacgcagattga

DBGET integrated database retrieval system