KEGG   Planococcus sp. MB-3u-03: CW734_17835Help
Entry
CW734_17835       CDS       T05387                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
plx  Planococcus sp. MB-3u-03
Brite
KEGG Orthology (KO) [BR:plx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CW734_17835
Enzymes [BR:plx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CW734_17835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_oxidored DAO FAD_binding_2 Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 K_oxygenase Glutaredoxin Thioredoxin_4 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AUD15208
LinkDB All DBs
Position
3319856..3321403
Genome map
AA seq 515 aa AA seqDB search
MILDAQIKSQLEQYLQLLEGDVLLQVSAGSDKVSTDMVDLVEELSAMSPRIQMERTELER
TPSFSVTRPGEEIGITFAGIPLGHEFTSLVLALLQVSGRAPKADPKTMDQIKNLEGSYHF
ESYISLSCQNCPEVVQSLNLMSVLNPNITHTMIDGAAFKEEVERKDIMAVPTVFLNGESF
ASGRMSLEELLAKLGSAPDASEFEDKEPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLSIENFVSVKHTEGPKFAASLEEHVKEYDIELMNLQRAKRLEKKELFELELE
NGAVVKGKTVILSTGARWRNIGVPGEEEFKNKGVAYCPHCDGPLFAGKDVAVIGGGNSGV
EAAIDLAGITNHVTVLEYNAELKADSVLQDRLKSLPNVTVLTNARTQEITGTDKVNGLSY
IDLQTGEEKHVELSGVFVQIGLVPNTDWLGDFVERTAHGEIIIDQRGATNMPGVFAAGDC
TNIPYKQIIISMGSGATASLSAFDHLIRSDIPVLV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcgcaaatcaaatctcaattagagcaatacttgcagctattggaaggc
gacgtgctgctccaagtgagcgccggatccgataaggtatcaacagatatggtcgatttg
gtggaagaactgtccgccatgtccccgcgcattcaaatggagcgcacggagcttgagaga
accccgagcttcagcgtcacccgtcctggagaagaaatcggcatcactttcgccggcatc
ccgcttggccatgagttcacttcgctcgtccttgccctgttgcaagtgagcggacgcgcg
ccaaaagccgacccgaaaacgatggaccagatcaaaaacctggaaggttcttatcatttt
gaatcctatatcagcttgagctgccagaactgcccggaagtcgtgcaatcacttaatttg
atgagcgtcctcaacccgaacatcacgcacacgatgatcgacggcgctgccttcaaagaa
gaagtcgaacgcaaagacatcatggctgttccaaccgttttcttgaacggcgaatcgttc
gcaagcggacgcatgtcgcttgaagaattgctcgcaaaacttggcagcgcaccggatgca
tccgaattcgaagacaaagagccgtttgacgtgctcgtcgtcggcggcggcccggctgga
gccagcgcagcgatctatgcggcacgtaaaggcatccgcacaggcatcgtcgcggagcgt
ttcggtggccaggtgatggataccttaagcatcgagaacttcgtcagcgttaagcataca
gaaggcccgaaatttgcggcaagcctcgaagagcatgtgaaagaatacgatatcgagctg
atgaacttgcagcgtgcgaaacgcttggagaaaaaagagctgttcgagcttgaactcgaa
aacggcgctgtcgtcaaaggcaagaccgtcattctttcaacaggtgcccgctggcgcaat
atcggcgttcctggcgaagaggaattcaagaacaaaggcgtggcgtactgcccgcattgc
gacggcccgttatttgccggcaaagacgtcgcggtcatcggcggcggcaattccggcgtc
gaagcggcgatcgaccttgcaggcatcacgaatcacgtgacggtgctggaatacaacgca
gagcttaaagcggattccgttttgcaggaccgcctgaagagcctgccgaatgtcacggtg
ctgacgaatgcacgcacacaggaaattaccggcaccgataaagtgaacggcctttcctat
atcgaccttcaaaccggcgaagaaaagcatgtcgaactatccggcgtcttcgtccaaatc
ggcctcgtgccaaacaccgactggctcggtgacttcgtcgagcgcacagcgcacggcgag
atcatcatcgaccagcgcggcgcaacgaatatgccgggcgtgtttgcggcaggcgactgc
acgaacatcccgtacaaacagatcatcatttcgatgggctctggcgcaacggcttcactg
agcgcgttcgaccaccttatccgaagcgatatccctgttttggtgtaa

DBGET integrated database retrieval system