KEGG   Pseudoalteromonas luteoviolacea: S4054249_03540Help
Entry
S4054249_03540    CDS       T04577                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
plz00250  Alanine, aspartate and glutamate metabolism
plz00410  beta-Alanine metabolism
plz00430  Taurine and hypotaurine metabolism
plz00650  Butanoate metabolism
plz01100  Metabolic pathways
plz01110  Biosynthesis of secondary metabolites
plz01120  Microbial metabolism in diverse environments
plz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:plz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    S4054249_03540
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    S4054249_03540
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S4054249_03540
   00430 Taurine and hypotaurine metabolism
    S4054249_03540
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    S4054249_03540
Enzymes [BR:plz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     S4054249_03540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS UPF0175
Motif
Other DBs
NCBI-ProteinID: AOT07003
LinkDB All DBs
Position
1:844127..845758
Genome map
AA seq 543 aa AA seqDB search
MGPKRCAVASEESLMRIFTVPEAPGSTLSKIEQEISHNLAGFLNENIAAIEKPLHEIEKD
FQDAAIPEEPKFVSDYAQDIMEQLVAHSVHTASPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLTYGKDEDFYQKWMHSAKNALGAFCSGGTIANITAL
WIARNRLLKPDGDFKGISSQGMFAAMMHYGYKGLAVLVSERGHYSLGKAADVLGIGRDNF
IAIKTDQDNKVDMQAMRDTAVELEAKGIKVMAIVGVAGTTETGSIDPLSEMAALCEELGC
HFHVDAAWGGATLLSNTYRHLLSGIEKADSVTIDAHKQMYVPMGAGIVLFKDPTATDVIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLQVIGRKGYEMLIDHSIEKAHYFANLI
SEQDDFELISQPELCLLTYRYVPREVKQALQVANEQEKLDIFAALNRLTASMQKRQRETG
RSFVSRTRLTPKQYDNQPTVVFRVVLANPLTSYQMLNDILKEQREMAQHDPVLKKYLSKY
LTN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggtccaaagcgttgtgcagtcgcttctgaagaaagcttgatgcgaatatttaccgta
ccggaagcacctggctctacactcagtaaaattgaacaagagatctctcataatctagcg
ggttttttgaacgaaaatattgcagcgattgaaaaacccctacatgagatagagaaagat
tttcaggatgcggcgatccctgaagagcctaagtttgtatctgactatgctcaagatatt
atggagcaactagttgcccactctgtccatactgcatctccaagttttattggccacatg
acatcggcattaccacactttttattgccgttatctaaactcatggttggactcaatcag
aacttagtaaagattgaaacgtcgaaagcgtttacacctcttgaacggcaagtattgggt
atgatgcaccatttgacatatggtaaagacgaagacttttatcaaaaatggatgcacagt
gctaagaatgcactcggagcattctgttccggtggcacaattgcgaatattacggcgttg
tggatagcacgaaaccgtttattgaaaccggatggtgactttaaaggcatctcttcccaa
gggatgtttgcagcaatgatgcattatggttacaaaggattagccgttttagtttcagaa
cgtggccactattctttaggtaaggcggctgacgtactgggcattgggcgtgataatttc
atcgcaatcaaaactgaccaagacaataaagttgacatgcaggctatgcgtgatactgct
gttgaacttgaggccaaaggcattaaagtaatggctattgttggcgtcgctggcactact
gaaacgggcagtattgatccgttaagtgagatggctgctctgtgcgaagagctaggttgc
catttccatgtggatgcggcatggggcggtgcgacattactttcaaatacttatagacac
cttctgtctggtattgaaaaagcggattcagtgactatcgatgcgcacaagcaaatgtac
gttcctatgggggcgggcattgtgctgtttaaagacccgactgccacagatgtgatagaa
catcacgcggaatatatattgcgtaaagggtcaaaagatttgggcagtcatactcttgag
ggcagtcgtcctggtatggcgatgttagtgcatgcatgtcttcaagtaattggtcgtaaa
gggtacgaaatgctcattgatcatagcattgaaaaagcgcactactttgcaaacttaatt
tcagaacaagatgattttgagcttatctctcaacctgagctatgtttgctgacatatcgc
tatgtaccacgagaagtaaagcaggcattgcaagttgcgaatgaacaagaaaagctggat
atttttgctgctttaaatcgactcacagccagtatgcaaaaaagacagcgtgaaactgga
cgctcatttgtctccagaactcgcttgactccgaagcaatacgataatcaacctaccgtt
gtttttcgggttgtattggcaaaccctttgacttcttaccaaatgcttaatgatattttg
aaagagcaaagagaaatggctcaacatgatccagtattaaaaaagtatttgagtaaatat
ttaaccaattaa

DBGET integrated database retrieval system