KEGG   Pseudoalteromonas luteoviolacea: S4054249_11050Help
Entry
S4054249_11050    CDS       T04577                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
plz00061  Fatty acid biosynthesis
plz01100  Metabolic pathways
plz01212  Fatty acid metabolism
Module
plz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:plz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    S4054249_11050
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:plz01004]
    S4054249_11050
Enzymes [BR:plz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     S4054249_11050
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     S4054249_11050
Lipid biosynthesis proteins [BR:plz01004]
 Fatty acid synthase
  Component type
   S4054249_11050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AOT08348
LinkDB All DBs
Position
1:2601728..2602243
Genome map
AA seq 171 aa AA seqDB search
MEPKNSYTKEELILCAEGKMFGENNCRLPIDNMLMMDRIVEINEDGGEFGKGQIIAELDI
NPDLWFFDCHFRGDPVMPGCLGLDAMWQIVGFFLGWSGGPGLGRALGVGEVKFTGQILPT
AKKVTYRVDMKRVIKRKLFMGLADGVVEVDGRVIYEAKDLKVGLFQDTSAF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaacctaaaaatagctatacaaaagaagaactaatcctttgtgctgaaggcaaaatg
tttggtgaaaacaactgccgtctaccaatcgacaacatgttaatgatggatcgtatcgtt
gaaattaacgaggatggtggtgaatttggtaaaggtcaaatcattgctgagttagacatc
aaccctgatctttggttcttcgactgccatttcagaggtgacccagtaatgcctggctgc
cttggtttagacgcgatgtggcaaattgttggctttttcctaggctggtcaggtggccca
ggtcttggccgtgcattgggcgtaggtgaagttaaatttactggtcagattctgcctact
gctaaaaaggtaacttaccgtgtagacatgaagcgtgttatcaagcgtaagctatttatg
ggccttgctgacggcgtcgttgaagttgatggtcgtgtaatctacgaagcaaaagatctg
aaagtaggtctattccaagatacaagcgcattctaa

DBGET integrated database retrieval system