KEGG   Pseudoalteromonas luteoviolacea: S4054249_11250Help
Entry
S4054249_11250    CDS       T04577                                 

Definition
(GenBank) hypothetical protein
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
plz00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:plz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    S4054249_11250
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plz01007]
    S4054249_11250
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plz03016]
    S4054249_11250
Enzymes [BR:plz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     S4054249_11250
Amino acid related enzymes [BR:plz01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   S4054249_11250
Transfer RNA biogenesis [BR:plz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    S4054249_11250
 Prokaryotic type
    S4054249_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon GPI-anchored
Motif
Other DBs
NCBI-ProteinID: AOT08386
LinkDB All DBs
Position
1:2645346..2646527
Genome map
AA seq 393 aa AA seqDB search
MINEHRKIGKQLQLFDMSNSASGMVDWYPQGYKLYRRIQSYIRTMQLKYGYHEVNSPVLA
NHDIWHTSGHSDKYQQNMFHLQEHNLAVRPMSCPFHINIFNNLVQSYKQLPYRIAEFGLC
HRNETSGSLNGLFRLRAFNQDDGHIFCRKSQIKSELKLFCNMLFEMYAHFGFQKEKIKIK
ISLRPDNKIGSDILWDKLEEYLKTGLDELGLHYQLINGDGAFYGAKVEFALEDSLKREWQ
CGTFQLDFFLAEKFGCTYQNESASPEYPVILHRAVLGSIERFIAILLEHYSGRLPVQFNP
NAIIFLPISKDHLNYCYSVHDKLRSIGIACNIDNSDNSISYRVKASYKQKCNYCIVIGDE
EQNTNILKLKHKKSCYSVHLDELAQFLLFPKTH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgagcatagaaaaataggtaagcaattgcagctttttgatatgtcgaacagt
gcatcaggtatggtcgactggtaccctcaaggatacaagctctatcgtcgtatacaatct
tatattcgtactatgcagttaaagtacggatatcatgaggtcaatagtcccgttcttgcc
aaccacgatatttggcacacttctggtcatagtgataaataccaacaaaacatgtttcac
ctgcaagaacataacttagcggtgagaccaatgagctgcccctttcacatcaacatattc
aataaccttgtacaatcatacaagcaactcccctaccgcattgccgagtttggtctttgc
caccgcaacgagacatcaggttcactcaacggccttttccgactgcgcgcttttaaccaa
gatgatgggcatatattttgtcgaaaaagtcagataaaaagtgagctcaagctgttttgt
aatatgttgtttgaaatgtatgcacattttggatttcaaaaagaaaagataaaaataaaa
atctcactacgcccagataacaaaatcggctctgatatcctttgggacaaactagaagag
tatctaaaaacaggcttagacgaacttggattacactatcaacttatcaatggagatgga
gcattttacggtgcaaaagttgagtttgcgctagaagattcactaaaaagagaatggcaa
tgcggtacgtttcaattggactttttcttagctgaaaagtttggctgtacataccagaat
gaatctgcatcgcctgagtatccagttattttacacagagctgttcttggctcaatagag
cgtttcattgctattttattagagcattacagtggaagattacccgtacagtttaacccc
aatgcaattatttttctgccaatcagtaaggaccacctaaattactgctactcagtacac
gataagctccgctcaataggtatcgcatgtaacattgataactcagataatagcatcagc
tatcgagtcaaagcatcttacaaacaaaaatgtaactactgcattgttataggagacgag
gagcaaaacaccaatatactcaagctcaaacataagaaatcgtgttactcagttcattta
gatgagctagcgcaatttcttttatttccgaaaacacattaa

DBGET integrated database retrieval system