KEGG   Pseudoalteromonas luteoviolacea: S4054249_13805Help
Entry
S4054249_13805    CDS       T04577                                 

Definition
(GenBank) hypothetical protein
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
plz00061  Fatty acid biosynthesis
plz00780  Biotin metabolism
plz01100  Metabolic pathways
plz01212  Fatty acid metabolism
Module
plz_M00083  Fatty acid biosynthesis, elongation
plz_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:plz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    S4054249_13805
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    S4054249_13805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:plz01004]
    S4054249_13805
Enzymes [BR:plz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     S4054249_13805
Lipid biosynthesis proteins [BR:plz01004]
 Fatty acid synthase
  Component type
   S4054249_13805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA PS-DH 4HBT MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AOT08864
LinkDB All DBs
Position
1:complement(3277878..3278297)
Genome map
AA seq 139 aa AA seqDB search
MISPDNLPHKPPFKFVDRVVEVQPNESIIAQKFIGYNEPCLEGHFPDEPVFPGVLIVEAM
AQASGLCITGKSKGVIAGIDKVKFLTPVLPGQVLEIRAMVEIALGELVKFKVAAWVNEQE
VASARIAIRYLEQIGEKDV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaccggataatttaccgcataaaccgccatttaagtttgttgatagagtcgtc
gaggtacagccgaatgagtctattatcgcacaaaagttcattggctataacgaaccttgt
ttagaagggcacttccctgatgaacctgtgttccctggcgtattgattgttgaggcgatg
gctcaagccagtggtctatgtattacgggtaagtctaaaggcgtgattgcagggatagac
aaggttaagtttttaacacctgtattacccggtcaggtattggaaattcgtgccatggta
gagattgcgttgggtgagcttgtgaagtttaaagttgcagcttgggttaatgaacaagaa
gttgcgagtgcacgcatagccattcgatatttagagcagataggagaaaaggatgtttaa

DBGET integrated database retrieval system