KEGG   Pseudoalteromonas luteoviolacea: S4054249_14090Help
Entry
S4054249_14090    CDS       T04577                                 

Definition
(GenBank) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
plz  Pseudoalteromonas luteoviolacea
Pathway
plz00500  Starch and sucrose metabolism
plz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    S4054249_14090
Enzymes [BR:plz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     S4054249_14090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AOT08919
LinkDB All DBs
Position
1:3345033..3346469
Genome map
AA seq 478 aa AA seqDB search
MTTQTNTVLKSEQEYPTAIDAQPLEKWAKVARQHVLDRMIANISPDDGERGAVLASPSRT
NPNYYYHWVRDAARTMSEIAKLNGLDRRNFKDNYYDMMIDYVEFTKINQTTPTVSNSLGE
PKFYVTGQAFNGPWGRPQNDGPAQRALTITRWAHTLLENGEKGYVTGTLYDSKEPSFSII
KADLDFVANHWQDPCFDLWEEVDGTHFYTRLLQRTALREGADLANKLNDPGAADYYNQQA
ALIESAMDDFWSEEQGYFLTTINRVGGLDYKSSNLDVATTLGICQALSDTHPFLNPHEDK
VLATAYALHQAFDPLYLINAIEHTTSGDPVSPGIGRYPEDKYAGSAPLGQGNPWFLCTAS
LSSICYKAAALFAEQKNIEINKYNLGQLDLAVKLVDPKCQLEVGGCFSSRTKTFKSITSG
LKALGDAYLRRIQIHAGEHTSLSEQFSRYDGYMTSAEHLTWSYVSVAIAIDLRNALKV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcaaacgaacacggtactcaaatcagagcaagaatacccgacagctattgat
gcacaaccacttgaaaagtgggcaaaagtggcaagacaacatgtgctagataggatgatt
gcgaatatttcacccgacgatggagagcgtggagctgtactcgcctctccctctcgcacc
aacccaaactactattaccactgggtcagagatgcggcacgaacaatgagcgaaattgcc
aagctcaatggccttgatcgtagaaattttaaagataactactacgacatgatgattgac
tatgtcgagttcaccaaaataaaccaaacaacaccaactgtcagtaatagcttaggcgag
cccaagttttacgtcactggacaagcgttcaacggaccttggggcagaccacagaatgat
ggcccagcgcaacgcgcgctcaccatcactcgctgggcacatactctgttagagaatggt
gaaaaaggctatgtcacaggcactttatacgactcaaaagagccttcatttagtattatc
aaagcagatttagattttgttgcgaaccactggcaggacccttgctttgacctgtgggaa
gaagtcgatggcacccatttttatactcgactgctacaacgcacagcgttgcgcgaaggt
gctgatttagcgaataagctcaatgatccgggcgcagccgattactataatcaacaggct
gcattgattgaaagtgcaatggatgatttttggagtgaagaacagggctattttctaacc
acgataaaccgtgttggcgggctagattacaagtcgtcaaatcttgatgttgcgacaact
ttagggatctgccaagcattgtcagacacccaccctttcctaaacccacacgaagataaa
gtactggcaaccgcctatgcacttcaccaagcttttgaccctctttatctgatcaacgcg
atagaacacaccacatctggcgacccagtctcaccgggcattggacgctacccagaggat
aaatacgcaggtagcgcgccacttggacagggtaacccttggttcttgtgtactgcctct
ttgagcagtatttgctacaaagcggcagccttgtttgcagaacaaaaaaatattgaaatc
aacaagtataacctcggccaactagatttggctgtgaaactggtcgaccccaaatgtcag
cttgaggtcggtgggtgtttcagtagtagaaccaaaacattcaagtccatcacctctggc
ttaaaagcgcttggagatgcctatcttcgccgtatccagatccacgcaggtgagcacacg
tcattgtcggagcaatttagtcgctacgacggctacatgaccagtgctgaacacctaact
tggagttatgtatccgtcgccatcgccattgatttacgcaatgcgttaaaagtttga

DBGET integrated database retrieval system