KEGG   Pseudoalteromonas luteoviolacea: S4054249_21000Help
Entry
S4054249_21000    CDS       T04577                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
plz  Pseudoalteromonas luteoviolacea
Brite
KEGG Orthology (KO) [BR:plz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    S4054249_21000
Enzymes [BR:plz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     S4054249_21000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored Thi4 NAD_binding_7 Glutaredoxin AlaDh_PNT_C K_oxygenase FMN_red FAD_binding_3 NAD_binding_8 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AOT10359
LinkDB All DBs
Position
2:44346..45914
Genome map
AA seq 522 aa AA seqDB search
MLDAQIKEQLKEHFKNIKSPVELKVALDSSSKSNELNSLAQDLALLSPNISIEENYDINA
RRPSLQVSSKQAKTQINFAGVPMGHEFTSLILALLHSGGHDTKLVTDELVIIKEIDKPLN
FEVYVSLSCQTCPQVVQALNVLAANNPNITTTMIDGALFQQEVEERNIMAVPSVYLNGEL
FSQGAIGLTDILKKLDSNSAQKEKDKLNNKPLFDVLVVGGGPAGASAAVYAARKGLNTGV
VAERFGGQVADTMSIENFISVKETEGPKLVAQLEQHVKQYDVDVMDSNRVTKIERNEFLD
IELENGAKLQAKSIVISTGARWRNVNVPGEEEYKGRGVAYCPHCDGPLFKGKPVAVIGGG
NSGIEAAIDLANIVEHVTVLEFASELKADQVLIDKAKSLPNIEIHTNAQTTEIMGDKNKV
NGLKYLNRVTTEEHLINVSGIFVQIGLVPNSEWLNSSDINLNKFGEIEIDNKGSTNMAGV
FAAGDVTTTPFKQIVIAMGSGATASLGAFEYLIRESGSSAAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgcaaattaaagagcagctcaaagagcactttaagaatattaaatcacct
gtagagttaaaagtggcgctcgatagcagcagtaagtccaacgaattgaactcgctcgct
caagatcttgctttactaagtcccaacatatcgattgaagaaaattacgatatcaatgct
agaagaccctctttgcaagtcagctcgaaacaggctaaaacacaaatcaattttgcgggt
gttcctatggggcacgagtttacgagcttgattttagcgcttttacacagcggtggtcac
gatacgaaactggtaactgacgagctcgtaatcattaaagaaatagataagccattaaac
tttgaggtatatgtatctttaagctgccagacttgtcctcaggttgttcaagctcttaat
gttttagctgcaaataatccaaatattaccacgacaatgatagatggcgcactattccaa
caagaagtagaagagcgcaacatcatggccgtgccgagtgtgtaccttaatggcgaacta
tttagtcagggtgcaatcggtcttactgatattttgaaaaagttagatagtaattcggca
caaaaggaaaaagataaactcaataacaaacctttgtttgatgtgttagttgttggtggc
ggtcccgctggcgcttcggctgcggtgtatgcagcgagaaaaggcttaaatacaggtgtt
gttgctgaacgttttggtggtcaggttgcggataccatgagcatagagaatttcatctca
gttaaagagactgagggccccaaattagttgctcaattggaacagcatgtaaagcaatat
gacgttgatgtgatggatagcaatcgggtcacaaaaatcgaacgtaatgagtttttagac
attgaattagaaaatggcgcaaaactacaagccaagtcgattgtgatttcaactggtgcc
agatggcgcaatgtaaatgtacctggtgaagaagagtataaaggccgaggagttgcgtac
tgcccacactgtgatggacctttatttaaaggtaaaccagttgctgtgatcggtggtggt
aactcaggtattgaggcggctattgatttagctaacatcgttgagcatgtcaccgtatta
gaatttgcaagcgaattaaaagctgatcaagtattaattgataaagcgaaaagtttacca
aatattgaaattcacacgaatgcgcaaaccacggagataatgggtgataaaaataaagta
aatggcttaaagtacctcaatcgtgtcaccacagaggaacatttaatcaatgtttcgggt
atttttgtacagattggactggtgcccaattcagagtggctaaatagtagtgatataaat
ttaaataaatttggtgaaattgaaatagataataaagggtctactaatatggcaggcgtt
tttgctgctggtgatgtgaccacaaccccttttaagcagatagtaattgcgatggggagt
ggcgcaacagctagtttaggtgcttttgagtacttaatacgagagtctggttcatctgcc
gctgcatag

DBGET integrated database retrieval system