KEGG   Prochlorococcus marinus subsp. marinus CCMP1375: Pro_0074Help
Entry
Pro_0074          CDS       T00137                                 

Gene name
accC
Definition
(RefSeq) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pma  Prochlorococcus marinus subsp. marinus CCMP1375
Pathway
pma00061  Fatty acid biosynthesis
pma00620  Pyruvate metabolism
pma00640  Propanoate metabolism
pma01100  Metabolic pathways
pma01110  Biosynthesis of secondary metabolites
pma01120  Microbial metabolism in diverse environments
pma01130  Biosynthesis of antibiotics
pma01200  Carbon metabolism
pma01212  Fatty acid metabolism
Module
pma_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pro_0074 (accC)
   00640 Propanoate metabolism
    Pro_0074 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pro_0074 (accC)
Enzymes [BR:pma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Pro_0074 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Pro_0074 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATPgrasp_Ter
Motif
Other DBs
NCBI-GeneID: 1461453
NCBI-ProteinID: NP_874468
CYORF: Pro0074
UniProt: Q7VED9
LinkDB All DBs
Position
85161..86510
Genome map
AA seq 449 aa AA seqDB search
MSLGKVLIANRGEIALRILRSCRELGIATVAVYSTTDREALHVQLADEAVCVGDSPSSKS
YLNVPNIIAAATSRGVDAIHPGYGFLAENDRFAEICKDHGIVFIGPSPDSIRSMGDKSTA
KSTMMGVGVPTVPGSKGLLANWEEASLLAKDMGYPVMIKATAGGGGRGMRLVNDQESIEE
LFKAAQGESEAAFGNAGLYMEKFIDKPRHVEVQILADSLGNVVHLGERDCSIQRRHQKLL
EESPSPALDEQLRMRMGEAAVSAAKSINYEGAGTVEFLLDRSGNFYFMEMNTRIQVEHPV
TEMVTGIDLVAEQLRIAGGEPISLTQDQIELRGHSIECRINAEDASHNFRPSPGRITGWL
PPGGPGVRVDSHVYTGYDIPPFYDSLIGKLIVWGNDRESALKRMKRALNECAVTGIPTTI
DFHLKLLERDEFLKGDVHTKFVEQEMLNK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgtctttaggcaaagttttaatagcgaaccgaggcgaaatcgctttaagaattctccgt
agttgtagggagttaggtattgcaacggttgctgtgtatagcactactgatagagaggct
ttacatgtccaacttgccgatgaagcagtttgtgttggagattcgcctagtagcaaaagt
tacctaaatgttccaaatattattgctgctgcaacatctagaggagtcgatgctattcat
cctggttatggttttctggctgaaaatgatcgctttgctgagatttgcaaagaccatggc
attgtctttataggtccctcgccagattccattagatctatgggcgataaatctactgcc
aaatcaacaatgatgggagtaggagtgcctactgtgcctgggagcaaaggattattggct
aattgggaagaggcttcattgcttgcgaaagatatgggctatccagtaatgattaaagct
actgctgggggaggaggaagagggatgcgattagttaatgatcaagaatctattgaagag
ctttttaaggcagctcagggtgaatcagaagctgcatttgggaatgctggtctatatatg
gagaaatttatagataaacctagacatgtagaagttcaaattttggcagatagtcttgga
aatgttgttcatttaggagaaagagattgttctattcaaagaaggcatcagaaattatta
gaagaatcccctagtcctgctttagatgagcaattaagaatgcgaatgggggaagcagca
gtttcagcagcgaaaagtatcaattatgagggtgctggcactgttgaatttcttttggat
agatcaggtaatttttattttatggaaatgaatacgcgaattcaggttgagcatccagtc
actgagatggttacaggtattgatttagtggccgaacaattgcggatagcaggaggtgag
ccaatttctcttacgcaagatcaaatagagctgcgaggtcactctattgaatgcagaatt
aatgctgaggatgcatctcacaacttccgtccttctccagggagaattacagggtggctg
cctccagggggccccggtgtaagagttgatagtcatgtttataccggttatgacataccg
cctttctatgattctttaataggtaaattgattgtttggggtaatgatagagagtcagca
ttgaaacgtatgaaaagagctttaaatgaatgtgctgttacaggtattccaacaacaatt
gactttcatttgaaattgcttgaacgtgatgaatttcttaaaggcgacgtgcatacaaaa
tttgttgagcaggaaatgctcaacaaataa

DBGET integrated database retrieval system