KEGG   Prochlorococcus marinus subsp. marinus CCMP1375: Pro_0401
Entry
Pro_0401          CDS       T00137                                 

Gene name
aceF
Definition
(RefSeq) Dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pma  Prochlorococcus marinus subsp. marinus CCMP1375
Pathway
pma00010  Glycolysis / Gluconeogenesis
pma00020  Citrate cycle (TCA cycle)
pma00620  Pyruvate metabolism
pma01100  Metabolic pathways
pma01110  Biosynthesis of secondary metabolites
pma01120  Microbial metabolism in diverse environments
pma01200  Carbon metabolism
Module
pma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pro_0401 (aceF)
   00020 Citrate cycle (TCA cycle)
    Pro_0401 (aceF)
   00620 Pyruvate metabolism
    Pro_0401 (aceF)
Enzymes [BR:pma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pro_0401 (aceF)
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Glutenin_hmw
Other DBs
NCBI-GeneID: 1461783
NCBI-ProteinID: NP_874795
CYORF: Pro0401
UniProt: Q7VDH5
LinkDB
Position
384875..386257
AA seq 460 aa
MASHDIFMPALSSTMTEGKIVEWLKQPGEKVSRGESVLVVESDKADMDVESFQDGFLAAV
LMPSGSTVPVGETIGLIVETEAEIPAVQAANPTKSNVSPPENLSVSKDSKQTSDDSKQTP
EDKPSTAEPFTSPKASSASLPAKAIINQGRIVATPRAKKLSTQLGVDLATVSGTGPHGRI
QAEDVQKAQGQPITVPWIAESNAPASIPTAPSVVVTESSRNRSQPVEVPKGNSFGNPGET
IPFNTLQQAVNRNMEMSLSVPCFRVGYAITTDKLDAFYKQVKPKGVTMTALLAKAVGKTL
ARHPQLNAAWSNEGMTYPKQINVAVAVAMEEGGLITPVLQNADLTDLFELSRQWADLVKR
SRTKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPNTGGILAVAASLPKVIAGRDGSISV
KRQMQVNLTADHRVVYGADGASFLKDLANLIENNPESLSS
NT seq 1383 nt   +upstreamnt  +downstreamnt
ttggcaagtcacgacatttttatgccagctcttagttcgactatgactgagggaaagatt
gttgaatggttaaagcaaccaggagagaaagtctctcgcggtgagtcagtacttgttgtt
gaatctgataaagctgatatggatgttgagtcatttcaagatggcttcctggccgcggtt
ttaatgccctcaggaagcactgtgccagtaggagaaacgattggcttgatagttgagact
gaagcggaaatccctgcagttcaggccgctaacccaaccaaaagtaatgtttcgcctcca
gagaatctttctgtttctaaagactccaaacaaacttcagatgattccaaacaaactcct
gaagataagccctctacagctgaacctttcacttctccaaaagcatcaagtgcatcattg
cctgctaaagcaataatcaatcaaggtcgaatcgttgcaacacctcgtgcaaaaaaactt
tctactcaacttggggttgatcttgcaaccgtttctggtactggtccacacggaagaatc
caagcagaagatgtccaaaaggctcaagggcaaccaataactgttccatggattgctgaa
agcaatgcgcctgcctctattccaactgcaccatcagttgttgtcactgagagttctagg
aatagatcgcagccagttgaagttccaaaaggcaatagttttggaaatcctggcgaaact
atcccatttaatacccttcagcaggcagtcaataggaatatggagatgagtttgtctgtt
ccttgtttcagagtagggtatgcaattacaacagataagcttgatgccttttataagcaa
gtaaagcctaagggtgtaactatgacagcgttgttggcaaaagctgttggcaagactctt
gcaaggcaccctcagctaaatgcagcttggagcaatgagggaatgacatatccaaaacaa
attaatgttgcagtagcagtggcaatggaagaaggaggtcttattacccctgtccttcag
aatgctgatctcacagatttgttcgaattatcacgtcaatgggctgatttggtcaaacgt
tctagaaccaagcaacttcaaccaaatgaatacaatagcgggacatttacactttcaaat
ttgggtatgtttggagtagatcgttttgacgcgatacttcctcctaatacaggaggcatt
ttggcagttgcagcgtctctccctaaagtcatagcggggagagacggatccatttcagtt
aagcgtcaaatgcaagtaaatctaactgctgaccatcgagttgtttatggtgcagatggt
gcttctttcttaaaagatcttgctaatttaattgagaataatcctgaaagcctttcttct
tga

DBGET integrated database retrieval system