KEGG   Prochlorococcus marinus subsp. marinus CCMP1375: Pro_0401Help
Entry
Pro_0401          CDS       T00137                                 

Gene name
aceF
Definition
(RefSeq) Dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pma  Prochlorococcus marinus subsp. marinus CCMP1375
Pathway
pma00010  Glycolysis / Gluconeogenesis
pma00020  Citrate cycle (TCA cycle)
pma00620  Pyruvate metabolism
pma01100  Metabolic pathways
pma01110  Biosynthesis of secondary metabolites
pma01120  Microbial metabolism in diverse environments
pma01130  Biosynthesis of antibiotics
pma01200  Carbon metabolism
Module
pma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pro_0401 (aceF)
   00020 Citrate cycle (TCA cycle)
    Pro_0401 (aceF)
   00620 Pyruvate metabolism
    Pro_0401 (aceF)
Enzymes [BR:pma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pro_0401 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 1461783
NCBI-ProteinID: NP_874795
CYORF: Pro0401
UniProt: Q7VDH5
LinkDB All DBs
Position
384875..386257
Genome map
AA seq 460 aa AA seqDB search
MASHDIFMPALSSTMTEGKIVEWLKQPGEKVSRGESVLVVESDKADMDVESFQDGFLAAV
LMPSGSTVPVGETIGLIVETEAEIPAVQAANPTKSNVSPPENLSVSKDSKQTSDDSKQTP
EDKPSTAEPFTSPKASSASLPAKAIINQGRIVATPRAKKLSTQLGVDLATVSGTGPHGRI
QAEDVQKAQGQPITVPWIAESNAPASIPTAPSVVVTESSRNRSQPVEVPKGNSFGNPGET
IPFNTLQQAVNRNMEMSLSVPCFRVGYAITTDKLDAFYKQVKPKGVTMTALLAKAVGKTL
ARHPQLNAAWSNEGMTYPKQINVAVAVAMEEGGLITPVLQNADLTDLFELSRQWADLVKR
SRTKQLQPNEYNSGTFTLSNLGMFGVDRFDAILPPNTGGILAVAASLPKVIAGRDGSISV
KRQMQVNLTADHRVVYGADGASFLKDLANLIENNPESLSS
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
ttggcaagtcacgacatttttatgccagctcttagttcgactatgactgagggaaagatt
gttgaatggttaaagcaaccaggagagaaagtctctcgcggtgagtcagtacttgttgtt
gaatctgataaagctgatatggatgttgagtcatttcaagatggcttcctggccgcggtt
ttaatgccctcaggaagcactgtgccagtaggagaaacgattggcttgatagttgagact
gaagcggaaatccctgcagttcaggccgctaacccaaccaaaagtaatgtttcgcctcca
gagaatctttctgtttctaaagactccaaacaaacttcagatgattccaaacaaactcct
gaagataagccctctacagctgaacctttcacttctccaaaagcatcaagtgcatcattg
cctgctaaagcaataatcaatcaaggtcgaatcgttgcaacacctcgtgcaaaaaaactt
tctactcaacttggggttgatcttgcaaccgtttctggtactggtccacacggaagaatc
caagcagaagatgtccaaaaggctcaagggcaaccaataactgttccatggattgctgaa
agcaatgcgcctgcctctattccaactgcaccatcagttgttgtcactgagagttctagg
aatagatcgcagccagttgaagttccaaaaggcaatagttttggaaatcctggcgaaact
atcccatttaatacccttcagcaggcagtcaataggaatatggagatgagtttgtctgtt
ccttgtttcagagtagggtatgcaattacaacagataagcttgatgccttttataagcaa
gtaaagcctaagggtgtaactatgacagcgttgttggcaaaagctgttggcaagactctt
gcaaggcaccctcagctaaatgcagcttggagcaatgagggaatgacatatccaaaacaa
attaatgttgcagtagcagtggcaatggaagaaggaggtcttattacccctgtccttcag
aatgctgatctcacagatttgttcgaattatcacgtcaatgggctgatttggtcaaacgt
tctagaaccaagcaacttcaaccaaatgaatacaatagcgggacatttacactttcaaat
ttgggtatgtttggagtagatcgttttgacgcgatacttcctcctaatacaggaggcatt
ttggcagttgcagcgtctctccctaaagtcatagcggggagagacggatccatttcagtt
aagcgtcaaatgcaagtaaatctaactgctgaccatcgagttgtttatggtgcagatggt
gcttctttcttaaaagatcttgctaatttaattgagaataatcctgaaagcctttcttct
tga

DBGET integrated database retrieval system