KEGG   Prochlorococcus marinus subsp. marinus CCMP1375: Pro_1730Help
Entry
Pro_1730          CDS       T00137                                 

Gene name
ppc
Definition
(RefSeq) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pma  Prochlorococcus marinus subsp. marinus CCMP1375
Pathway
pma00620  Pyruvate metabolism
pma00680  Methane metabolism
pma00710  Carbon fixation in photosynthetic organisms
pma01100  Metabolic pathways
pma01120  Microbial metabolism in diverse environments
pma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pro_1730 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Pro_1730 (ppc)
   00680 Methane metabolism
    Pro_1730 (ppc)
Enzymes [BR:pma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Pro_1730 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HEAT_2
Motif
Other DBs
NCBI-GeneID: 1463112
NCBI-ProteinID: NP_876121
CYORF: Pro1730
UniProt: Q7V9U4
LinkDB All DBs
Position
complement(1580807..1583812)
Genome map
AA seq 1001 aa AA seqDB search
MTELDNFSMLEASKQVPDRKESSQILADHMSGRLLQKRLELVEDLWETVVRSECPLEQVE
RLLRLKQLSNSSGIVGEEQTNQINEIVELIKEMDLAEAISAARAFSLYFQLVNILEQRIE
EDSYLESISRGQEEKINTSIDPFAPPLASQTAPATFSELFDRLRRLNVPPGQLEELLREM
DIRLVFTAHPTEIVRHTVRHKQRRVASLLQQLQSDEVFSLSERDNLRLQLEEEIRLWWRT
DELHQFKPTVLDEVDYALHYFQQVLFDAMPQLRRRICSALSQSYPDIDVPQEAFCTFGSW
VGSDRDGNPSVTPEITWRTACYQRKLMLDRYMHSVQELRNQLSISMQWSQVSTQLLESLE
MDRVRFPHIYEERAARYRLEPYRLKLSYTLERLKFTQQRNQELSEAGWATTIERTNVSNN
PDEDLHYCSIDEFRRDLELIRNSLVATNLSCEQLDTLLTQVHIFAFSLASLDIRQESTRH
SEAIDELTRYLNLPKSYIEMTEDEKVIWLMDELQTLRPLIPSAVQWSKSTEETFAVFRML
DRLQKEFGSRICRSYVISMSHTVSDLLEVLLLAKEYGLVDISSESSDLLVIPLFETVEDL
QHAPSVMEELFQSEIYLKLLPRVGEKSQPLQELMLGYSDSNKDSGFLSSNWEIHQAQIAL
QNLASSHGVALRLFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLP
ELALYNLETVTTAVLQNSLVTNQWDATPSWNELMTRLAVRSRQHYRALVHDNPDLVAFFQ
EVTPIEEISKLQISSRPARRKTGAKDLSSLRAIPWVFGWTQSRFLLPSWFGVGTALEEEL
KSDPDHIELLRMLNQRWPFFRMLISKVEMTLSKVDLEVAYHYMTSLGSHENREAFNCIFE
IISNEYKLTRRLVLEITGKPKLLSADPALQLSVDLRNRTIVPLGFLQVALLCRLRDQNRQ
PPMSETLLTEGDIGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgactgaattagataatttttcgatgttagaagcatctaaacaagttcctgatagaaaa
gaatcgagtcagattttagccgaccatatgtctggcagactattacagaaacgtttggag
ttagttgaggacctttgggaaactgttgtgcgtagtgaatgtccattagagcaagtagaa
cgtcttttacgcctaaaacaattaagtaactcaagtgggattgttggggaagaacagact
aatcaaattaatgagattgttgaattgatcaaagaaatggatttggcagaagctatttct
gcggctagagcgttttccttatattttcagttagtgaacatccttgagcaaagaattgag
gaagatagttacttggaaagtattagtcggggccaagaagaaaaaattaatacttctata
gacccgtttgctcctccattggcaagtcagactgctccagcaacttttagtgaacttttt
gaccgcttacgtcgcttaaatgttccgccaggacagctggaggagttgttaagagaaatg
gatattcgacttgtttttacagcacaccctactgaaatagttagacatacggttagacat
aagcaacgccgagtagctagtttattacaacagcttcaatcagatgaagtcttttcattg
tctgagagagataatttaagattgcaattagaggaggagataagactatggtggcgaacg
gatgagctacatcaatttaagcctacagtgttagatgaagttgattatgcactgcactat
tttcaacaggtcttatttgatgcaatgcctcagctgcgccgtcgaatttgttctgctcta
tctcaaagttatccagatattgatgttcctcaggaagcattttgtactttcgggtcgtgg
gtcggctctgatagagatggcaatccgtctgtaacaccggagattacgtggcgtactgct
tgttatcaacggaagttgatgttggatcgctatatgcattcagtacaagaattgagaaat
caattgagtatctcaatgcaatggagtcaagtgagtactcaacttcttgaatctttggaa
atggatcgtgttcgttttccacacatttatgaagaacgagcagctagatacagacttgaa
ccttatcgattaaaactaagttatacacttgagcgtttgaagtttactcaacaacgcaat
caagaactttcagaagcaggttgggcgacaactatagaaaggactaatgtctctaataat
cccgatgaagatctacattattgctctattgatgaatttagaagggatctagaactgatt
agaaacagtctggttgcaactaatttaagttgtgaacaattagatacactattgactcag
gttcatatttttgccttttcattggcaagccttgatattcgacaagaaagtactcgtcac
agtgaggccattgacgaattaacgagatatctcaatcttcccaagagctatatagagatg
actgaagatgagaaagttatatggttgatggatgagctgcaaacattgagaccattaatt
ccttcagcagttcaatggtccaaaagtactgaagaaacatttgctgtatttagaatgctt
gatcgcttgcaaaaagagtttgggagccggatatgccgttcatatgtaatttcgatgagt
catacagtttctgatcttttggaggttcttcttcttgcaaaagagtatggattagtagac
atctcttcggaatcttctgatttactagttattcctttgtttgagacagtcgaagatctt
caacatgctccatcggtgatggaggaattatttcaatctgagatttatcttaagttatta
cctcgagtgggggaaaaatctcaaccactacaagagctaatgcttggttattctgatagc
aacaaagattcaggttttttatcaagcaattgggagattcatcaggcgcaaatagctctt
cagaatttagccagtagtcatggagttgctttacgcttatttcatggtcgtggtggatct
gttggtagaggagggggacctgcgtatcaagccatacttgctcaacccagtggaacatta
aaaggacgcattaaaattacggaacaaggagaagtcctagcgtcaaaatacagcctgcct
gaacttgcgctttataaccttgagacagtgacaacagctgtgttgcagaacagcttggta
actaatcaatgggatgcaactcccagttggaatgagttaatgacacgtttagctgtccgc
tctaggcaacattacagagcccttgttcatgacaatcctgatttagttgctttttttcaa
gaagtaactccaatagaggagattagtaaattgcaaatatctagtcgccctgctcgtagg
aaaactggtgctaaagatctttcgagcttaagagctattccatgggtttttggttggaca
caaagtcgttttcttttacctagttggtttggtgttggaacagctttggaagaagaactt
aagtctgatccagaccacattgaattgttaaggatgcttaatcagcgttggccttttttt
cgtatgttgatctctaaggtagagatgactctttctaaagtagatctagaggttgcttac
cattacatgactagtcttggaagtcatgaaaatagagaagcgtttaattgtatttttgaa
ataatttctaatgagtacaagttaactaggcgattggttttagaaatcactggtaagcca
aaactattgagtgctgacccagcattacagttgtcagtagatctacgtaatcgcacaata
gtgcctttaggctttcttcaagtggctttactctgtcgtttacgtgatcaaaatcgacag
ccacctatgagtgagactttgttaaccgaaggtgatattggacgtacgtatagtagaagt
gaactcttaagaggtgctttgttaaccattaatggcattgcggctgggatgcgcaacaca
ggttaa

DBGET integrated database retrieval system