KEGG   Papilio machaon (common yellow swallowtail): 106710663
Entry
106710663         CDS       T05138                                 

Definition
(RefSeq) uncharacterized protein LOC106710663
  KO
K20017  Bcl-2 family protein
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac04214  Apoptosis - fly
pmac04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    106710663
   04215 Apoptosis - multiple species
    106710663
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 106710663
NCBI-ProteinID: XP_014358276
LinkDB
Position
Unknown
AA seq 378 aa
MVKRVLNEDLGLRAYRRKTGHRLNARLMDLRLKRCRATMFNNRHWIGASKDLRWQSGGRR
TQEVNNIAIHVTPPDGEEDDEIVPPLRARRKLSSPLSGLPNAESSLVGPAPRSLSPLDRT
RRRFSTMVSSAAAAAVSRRLSATIGWCLASPTQVKPQIVRQGRALCLQYIKTQIRRSSIC
PNKQIVMKRLQQMLETECGEEAAVNLESGVLAALRALCAALERKQPDAFRHIARQATRAP
ATMLRSDVALAELALALARRVTRENITWSKIAAVYCICGALAREAAEASEGEPPIELVAA
PAAAIADVLHEETGSWIAAHGGWNGLIERLRVSDRDQRSEKTLRVMVSFFITACLLLLLL
RWANILLTSPRDYIVEDI
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggtgaaaagggtgttaaatgaagacttagggcttcgtgcatatcgaagaaaaacagga
catcgtttgaatgctcgtctaatggacctgagactgaagagatgccgcgctaccatgttc
aataacaggcactggataggggcttcaaaagatctaagatggcaatcgggtgggaggaga
actcaagaggtcaacaacatagcaatacatgtcactccaccagatggcgaagaagatgac
gagattgtgccgccgctgcgagcgcgcaggaagctgagcagcccgctcagcggcttgccc
aacgctgagagcagccttgtcggacccgcaccccgctcgctatcacctctggatcgtaca
agaagacgcttcagcacgatggtttcgagcgcagcggcggccgccgtgtcccgccggctg
tccgccaccataggctggtgcctcgcctcgccaacacaagtcaaaccacaaatagtccga
caaggacgtgccttgtgcttgcagtacataaaaacacaaattcgcagatcatctatatgc
ccaaataagcaaatagtaatgaaacgtttgcaacaaatgctggagacggagtgcggggag
gaggctgcggttaacctggagagcggcgtgctggcggcgctgcgggcgctgtgtgcggcg
ctcgaacgcaagcaacctgacgctttccgccacatcgcgcgccaggctacgcgcgccccc
gccaccatgctgcgctcggacgttgcgctcgccgaactggcgctagctctcgccaggagg
gtcactagagaaaacatcacctggtctaagatagcagctgtgtactgtatatgcggcgcc
ttggcgcgtgaggccgctgaagcctcggaaggtgagcctccgattgagctggtggcagca
ccggccgccgctatcgccgatgttttacacgaagagacaggctcttggattgctgctcat
gggggatggaatggtctaatagaacgattacgtgttagcgaccgtgaccaaagatccgag
aagaccctgcgtgttatggtgtcgttcttcataacggcatgtctgctgttactccttctc
agatgggccaacatcctactgacctcgcctagagactacatcgtagaagacatttga

DBGET integrated database retrieval system