KEGG   Papilio machaon (common yellow swallowtail): 106711542Help
Entry
106711542         CDS       T05138                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00040  Pentose and glucuronate interconversions
pmac00051  Fructose and mannose metabolism
pmac01100  Metabolic pathways
Module
pmac_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    106711542
   00051 Fructose and mannose metabolism
    106711542
Enzymes [BR:pmac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     106711542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2
Motif
Other DBs
NCBI-GeneID: 106711542
NCBI-ProteinID: XP_014359369
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
MTQDNLTAVLYKPKDLRLEQTPIPEIDDDEVLLRMDCVGICGSDVHYWQTGACGAFVMHE
PMIMGHEASGVVAKIGSKVKNLAVGDRVAIEPGVPCRYCEFCKSGRYHLCPDMRFCATPP
IHGNLARYYKHAADFCYKLPPHVSMEEGALLEPLSVGIHACRRGGVAAGQSVLVLGAGPI
GLVTMLAARAMGASKILITDILQSRLDFAKQLGADHTILVTRDASEEQLVQEVRRLLGDS
PDVSIDASGAQATVRLALLATKSGGVAVLVGMGSPELTVPLAGSVAREVDIRGIFRYVNE
YPIALSMVASGQINVKPLVTHHYTLEETLEAYEVARKGLGIKVMIHVQPRDTNNPQS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagataacctcaccgccgtcttatacaagcccaaagatttaagattggaacaa
actccgatacctgaaatcgacgacgatgaggtactacttcgcatggactgcgttggcatc
tgcggctcggacgtgcactactggcagactggggcatgcggggcatttgtcatgcacgaa
cccatgatcatgggacatgaagcttcaggagttgtggcaaagattgggtctaaagtaaag
aaccttgcggtgggtgaccgcgtggcgatcgagccaggcgtaccgtgccgctactgcgag
ttctgcaagtcgggccgctaccacctctgccccgacatgcgcttctgcgccaccccgcca
atacacggcaacctcgccagatattacaagcacgccgctgacttctgctacaaactaccc
ccccacgtgtcgatggaagagggtgcactactggaacctttatctgtgggtatccacgca
tgccggcgcggtggtgtggcggccggacagagcgtgctggtgctgggcgccggacctatt
ggactggtcaccatgttggccgcgcgcgccatgggcgccagcaagattcttatcactgat
atcctacagtcccggctggacttcgcgaagcagttgggtgcggaccacacgatcctggtg
acgagagatgccagcgaggagcagctggtgcaggaggtgcgccgcctgctgggcgacagc
cccgacgtctccattgacgcgagcggcgcgcaggccaccgtgcgcctcgcactactggcg
accaagtctggcggcgtggcggtgctggtaggtatgggcagccccgagctgacggtgccg
ttggccggctctgtggcgcgagaagtcgacatacgcggcatcttcagatacgtcaacgaa
tatcccatagcactttctatggtggcaagcggacaaatcaatgtgaaaccactagtcaca
caccattataccttggaagagaccttggaggcttacgaggtggcccgcaagggtctgggc
atcaaggtcatgatccacgtccagccccgcgacaccaacaacccacagtcataa

DBGET integrated database retrieval system