KEGG   Papilio machaon (common yellow swallowtail): 106713488
Entry
106713488         CDS       T05138                                 

Definition
(RefSeq) uncharacterized protein LOC106713488
  KO
K16679  wengen
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac04013  MAPK signaling pathway - fly
pmac04214  Apoptosis - fly
pmac04215  Apoptosis - multiple species
pmac04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    106713488
   04391 Hippo signaling pathway - fly
    106713488
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    106713488
   04215 Apoptosis - multiple species
    106713488
SSDB
Motif
Pfam: TNFR_c6 stn_TNFRSF12A
Other DBs
NCBI-GeneID: 106713488
NCBI-ProteinID: XP_014361785
LinkDB
Position
Unknown
AA seq 188 aa
MKLSIKVMRGDIRACLLVIAVALCSAAAGAGSGPCERGRSWWHRRRGACLPCTRCDPARL
AVKYPCEVHRDTVCQPLYEVRIFPFNVRPRRKNDSRHSEQSSDYEYYEYSDYSGEVTDKS
DDVIEWDVQTSTLTLAVSGCVVFFAVVLILSLYHARQWKVLKQALKSGTDMTKKGLVGNV
YTQEKPAS
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaagttaagcattaaggtgatgcgaggagacatccgcgcatgcctactggttattgcg
gtggcgctgtgcagcgcggcggcgggtgcggggtcggggccatgcgagcgcgggcgcagc
tggtggcaccggcggcgcggcgcctgcttgccctgcacacgctgcgaccccgcccgcctc
gccgtcaagtacccctgcgaggtgcaccgcgacaccgtctgccagccgctctacgaggtt
cgcatcttccccttcaacgtccgcccgcgcaggaagaacgacagccgccacagtgaacag
tccagtgattacgaatactacgagtattcagactatagcggcgaagtgacggataaaagt
gacgatgtgatagaatgggatgtgcagacgtccacgttgacgctcgcagtgagtggctgt
gtggtgttttttgcggtggtgttaatactgtcgctttaccacgccaggcagtggaaggtg
ctcaagcaagcgctcaagtctggtacagatatgacgaagaaaggactcgttggcaacgtg
tatacgcaagagaagcccgcgtcttag

DBGET integrated database retrieval system