KEGG   Papilio machaon (common yellow swallowtail): 106713926Help
Entry
106713926         CDS       T05138                                 

Definition
(RefSeq) phospholipase A1-like
Organism
pmac  Papilio machaon (common yellow swallowtail)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase NKWYS
Motif
Other DBs
NCBI-GeneID: 106713926
NCBI-ProteinID: XP_014362319
UniProt: A0A194RQL7
LinkDB All DBs
Position
Unknown
AA seq 356 aa AA seqDB search
MHRHTALFTLLAILSPLQVTAQGVRRSESDLTFAELLYVRLSSACRALVDLQFNSMSSQD
DIVKTMKITHLDNTMRKTFAIDRAYQTLTQPAMFDITKQTKIIIHGFRDSSQSSVSQDLA
DAYNDKQIFNVLLVDAEEMMNKGYVLSVHNARLVGKRLANLLANLETFGANAEDFHLLGI
SLGAHIAGWTGKYFRQYKSRSIGRITGLDPAGPCFSYTYADQRLDKTDALYVDVVHSNRL
IQGVIEPLGHADFYINGGGPVQPGCMVPSCSHLRAATVYAESIKTPKSFVGIRCKSWQHF
EQNTCEKDLAVLGYGSSIKSRGLYYLRTSGSSPFGLGMEGTKNKKPPVDSWLMALT
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgacacaccgcgctgtttacactgctcgcgatcttgtcgccgttacaagtgaca
gctcaaggtgtacgccgctctgaatcagaccttactttcgcagaactcctctacgtacga
ctctctagcgcatgcagagctctagtggacctacagtttaattcaatgagcagtcaagat
gacattgtaaaaacaatgaaaattacccatcttgataacactatgagaaaaacatttgct
atagatagagcataccaaacactcacacaacccgccatgtttgatattacaaagcaaacg
aaaatcattattcacgggtttagagatagttcccaatcatcggtctcacaggatttagct
gacgcttataatgacaaacaaatatttaatgtcttgttagttgatgcagaagaaatgatg
aataaaggatacgttttatccgtacataacgctcgtttggttggaaagagattagcaaat
ttgttggcgaatttagaaaccttcggagcaaacgctgaagactttcatcttctcggcatc
agccttggcgctcacatcgccggttggaccggaaaatatttccggcagtacaaaagtcgt
tctataggacgaataactggcttggatcctgccggaccttgcttttcttacacatatgcc
gaccagagactggacaaaactgacgccttgtacgttgatgtagtacattctaacaggtta
attcaaggcgtcatagaaccactgggtcacgccgatttctatattaatggtggtggaccg
gtgcagcccggatgcatggtaccatcctgcagtcatctgcgagcggcgaccgtttatgct
gaaagtataaaaacacctaagtcatttgtgggtatcagatgtaaaagctggcagcatttt
gagcaaaatacctgcgaaaaagacctcgctgtgctcgggtacggatcttcgataaagtca
cgtggactttattatctacgaacatcaggaagttcaccatttggactgggaatggaggga
acgaaaaataagaaaccgcccgtcgacagttggttaatggctttaacttga

DBGET integrated database retrieval system