KEGG   Papilio machaon (common yellow swallowtail): 106715870Help
Entry
106715870         CDS       T05138                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00020  Citrate cycle (TCA cycle)
pmac00190  Oxidative phosphorylation
pmac01100  Metabolic pathways
pmac01200  Carbon metabolism
Module
pmac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pmac_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106715870
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106715870
Enzymes [BR:pmac01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106715870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 106715870
NCBI-ProteinID: XP_014364714
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MFFATRKSIDVLIRTINIKNAVHKLQSRNKAYEIQHHQHDCLVIGAGGAGLRASFGLAQH
NLSVALVSKLFPTRSHTIAAQGGMNAAIGSMHEDDWRWHFYDTVKGSDWLGDQDSIHYLT
REAPNRVFELENMGMPFSRTKDGKIYQRPFGGGTIKNGKETAKRTCAVADRTGHSLLHTV
YGYCTKFEHVDFFHEYFVLDILCQDGAVVGALAMNMDDSTLHRFQAKNTVITTGGYPRMY
FSCTAAHTCTGDGCAMASRAGIPLQDMEFIQFHPTGMYGSGCLMTEGCRGEGGFIVNNKG
ERFMEKYAPKAKDLASRDVVSRSMATEIRQGRGVGPKKDHLYLQLHHLPAEVIRDRLPGI
SETAYIFTGVDVYTQPVPILPTVHYTMGGIPINYKGEALIYQGSDCPIPGLHAAGEAVSN
CHGANRLGANSILDVVVFGAAIGHNIGSKFKPGEKQPQLRDNICDASLDNLDKVRNSKGC
VAPHELRASMRNTMQHKCGVFREAKLLNEGNTEIQKWYRAFDQINVTDQRTNWNTDLIET
LELQNMLQAAIQVVACALNRTESRGAHFRDDFPKRIDEMDYSKSTEGQTPKPIEQHWRKH
TLSIPDLATGKVHISYRPVIDKTLDDEVKTIPPVPRVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgttttttgcaacaaggaaatctatcgatgtccttattcgaacgatcaacattaagaat
gcagtccacaaattgcaaagtcgaaacaaggcgtatgagattcagcatcatcagcacgac
tgcctggtgataggagcgggcggggccggcctgcgcgcctcatttggcctagcgcagcac
aacttatcagtggccctcgtatctaagttgttccccaccaggtcgcacaccattgccgct
caaggtggcatgaacgctgccataggcagtatgcacgaagacgattggagatggcacttc
tacgacacagtgaaaggctcagattggctcggtgatcaggattcaatccattatctcaca
cgcgaagcgccaaaccgggtctttgaattggaaaacatgggaatgcctttctctcgtacc
aaggatggaaaaatttaccagcgacccttcggtggcggaactataaagaatggaaaagaa
actgcaaaaagaacatgtgcagtggctgatagaacgggtcattcgctccttcacacggtt
tatggatattgcactaagttcgagcacgttgacttcttccacgagtactttgtacttgac
attctctgtcaggatggcgccgtagtcggtgcgctcgctatgaacatggacgatagtaca
ttgcacagattccaggcaaagaacactgtgatcacaactggagggtacccgcgaatgtac
ttctcgtgcacggcggcgcacacatgcacaggcgatggctgcgcgatggcctccagagct
ggtataccactacaggatatggagtttatacaattccatcctactggtatgtacggttct
ggttgcctgatgactgagggttgtcgtggagaaggtggcttcatcgtgaacaacaaaggc
gagcggttcatggagaagtatgcgccgaaagctaaagacctcgccagtagggatgttgtg
tctagatcaatggccacagagattcgacaaggtcgcggtgttggacctaagaaagaccat
ctttacctccaactacatcacttaccagccgaggtgatcagagatcggttgcccggtatc
tcggagaccgcctacatattcaccggagtggacgtgtacacacaacctgtacctattcta
ccgactgtgcattacactatgggaggtatacctatcaactacaaaggagaggctcttatt
taccaaggctccgattgtcctattcccggacttcacgctgcgggcgaagcggtcagcaat
tgccacggagccaaccgcctcggcgccaactctatcctagatgtcgtcgtcttcggagct
gccattggtcataacattggcagcaagtttaagcccggagaaaagcaaccgcaactcaga
gataatatctgcgacgcatcactggataaccttgacaaggttagaaactcaaagggctgc
gtggcaccgcacgagctgcgcgcctctatgaggaacaccatgcagcataagtgtggcgta
ttcagagaggctaaattgctgaatgaaggtaacactgaaatacaaaagtggtacagggct
ttcgatcaaatcaacgtgaccgatcagcgaacgaactggaatacagatcttatagaaact
ctggagcttcagaacatgctgcaggctgctatccaggtcgttgcctgcgctctcaataga
acagagagccgcggtgctcatttcagggatgacttccctaaacgcattgatgagatggat
tacagcaagtcaactgaaggccagacacctaagccaattgagcaacattggaggaaacat
accctttcaattcccgacctggctactggcaaagtacacatctcgtatcgtccagttatc
gacaagactttagatgatgaggttaaaactattccaccagtgccaagagtttattaa

DBGET integrated database retrieval system