KEGG   Papilio machaon (common yellow swallowtail): 106715989Help
Entry
106715989         CDS       T05138                                 

Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pmac01009]
    106715989
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pmac03019]
    106715989
   04131 Membrane trafficking [BR:pmac04131]
    106715989
   03036 Chromosome and associated proteins [BR:pmac03036]
    106715989
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106715989
Protein phosphatases and associated proteins [BR:pmac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106715989
Messenger RNA biogenesis [BR:pmac03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     106715989
Membrane trafficking [BR:pmac04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    106715989
Chromosome and associated proteins [BR:pmac03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106715989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var ArfGap
Motif
Other DBs
NCBI-GeneID: 106715989
NCBI-ProteinID: XP_014364890
LinkDB All DBs
Position
Unknown
AA seq 1057 aa AA seqDB search
MSTPLPPQQQRRSAGESKKCTPTSNILTRNGARKAKIQTRAMSAGAKPSAVIIAAKRKNF
KKKQVIDTLLKDFYQIAMDSKAKVKGPTGLVTEPRMAEHRCLWDENYPECPERLIEVLQR
CRELNLIEQCKQYAPRTATKEELLTLHSASVYETLEATHENNDIEYLEEVSSKYDAIYIH
PSTHELALLAAGSTIDMVDRIVSGEVQNGAALVRPPGHHAMRAEPCGYCFYNNVALAAKH
AIDNRGLTRILIVDWDVHHGQATQQMFYEDDRVVYFSIHRYEHGKFWPSLRQSDFNYVGE
GRGKGYNFNVPLNTTGLGDADYLAIWHQLLMPMAFEYQPELIIISAGYDAAIGCPEGEMQ
VTPACYATLLHLLMSVCPALCVVLEGGYCLPSLAEGAALTLRTLLGHPPPMLIQTGEPSD
SIRESILNCIYVQKPYWRCFKYQPTYNVGNVLEISDEVKQKHIVLHKWEGDETRPDKFAT
RDCYPMQDNETKRKNEDRLNHLRIVTDLSLPQHAVCYIYDEAMLKICEPAHVECPERIMR
IHERLRDFGLLQRLHPLTARPATDHEILAVHTQKHLDRLKELASTKLRYLNSQKDDYNSV
YFHPDTLESAAVAAGCVLQTVDAVLSKVAGAGVCVVRPPGHHADADILYISIHRYDNGTF
FPHSKDADYGAVGEGAGEGYNVNIPWNKRGMGNAEYMAAFTQVVLPIAYEYNPELVIVSA
GFDACINDPLGGCKVLPECYGRMTQMLKGLAGGKIILCLEGGYNIVSTSYAMTMCTKALL
GDPIEFNYNPEEEIHWSAVETINNVIKTQKKYWKSLKFQLALPIKNVLDKPSPSRGLIVS
TPVPQKSLSSNVTSKSSNGLQSLESDMMNLTINKCADGIHCGTDDEDDNGTDTNAGCSKS
SGEGSSKTVSDKGNKESEKQTLVDYLSENMQALVDGEMFAVVPVPWCPHLDTLFAIPESV
KFEQGVKCVDCEEKNENWVCLHCYITACGRSINGHMQAHHRATQHPLVLSLLDLSVWCNI
CDAYVDNPLLYDAKNNAHKCKFGEDMPWCYKTDIHMA
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccctctaccaccgcaacagcaacgtcgttctgctggagagagtaaaaaatgt
acaccaacgtcgaatatacttacaagaaacggtgcacgaaaagcaaaaattcaaacaagg
gctatgtcagcaggtgctaagccatctgccgttattattgctgcaaagaggaagaatttt
aagaagaaacaagttattgatacactgttaaaggacttttaccaaattgcaatggactcc
aaagccaaggtcaaaggtcccacgggccttgtaacagagcctcgtatggcagagcacagg
tgcctgtgggatgagaattatccagaatgtccggaaagattgattgaagttttgcagaga
tgtcgtgagttgaatttaatagagcaatgcaagcagtatgcaccaagaacagcgactaaa
gaagagctcctcaccctacactcagcttctgtgtacgaaactctggaggctacacatgaa
aataatgatattgaatatttagaagaagtctcttcgaagtatgatgctatttatatacac
cctagtacccacgagttagcactcctcgcagcgggttctactatcgacatggtagaccgt
attgtaagtggtgaagtacagaacggcgcggctctagtccggcctcccggacaccacgcc
atgcgcgctgaaccctgcggctactgcttctacaacaatgtcgcactcgcagccaaacat
gctattgacaatagaggactcactaggattctgatagtggattgggatgtacatcacgga
caagccactcagcagatgttctatgaggacgacagggtggtatatttctctatccatcgc
tacgagcacggtaagttctggccgagtctgcgtcagtcggacttcaattatgtgggggag
ggtcgcggcaaagggtacaacttcaatgtgccgctcaacacgaccggtctgggagacgca
gactacctcgctatatggcatcaacttctcatgcctatggcttttgagtaccaaccggag
ctgataattatatctgcgggctacgacgctgccatcggctgtcctgagggtgagatgcaa
gtgactcccgcatgttatgcgaccctgttgcatttactgatgtctgtgtgccccgcgctg
tgcgtggtgctggagggtggctactgcttaccctcgctggcggaaggtgccgcgctcaca
cttcgcacgctgttaggacatccgccaccaatgctcattcaaactggagaacctagcgac
tcgatccgcgaatcgatactaaactgtatttacgtacagaagccatattggcgttgtttc
aaatatcagcctacgtacaatgtaggcaatgtattggagatcagcgacgaagtgaaacag
aagcatatagttttacacaagtgggagggagacgaaactagacctgacaagttcgctact
agagactgctatccgatgcaagacaacgagacaaagagaaaaaatgaggatagattgaat
catttaaggatagtaacggacttgtcattacctcagcacgctgtgtgttacatttacgac
gaagctatgctcaaaatttgcgagccagctcatgttgagtgtccggagcgtataatgcgc
atccacgagcggctccgagacttcgggctgctgcagcgcctgcacccgctgaccgcgcgc
cccgccacagaccacgagatactggccgtgcatacacagaagcatctcgatagactaaaa
gagttggcgagtaccaaactgcgttatctaaacagtcagaaagatgattacaactcggtg
tacttccatccggatacgttggagagcgcagctgtggccgccggatgtgttttacagacg
gtagatgcagttttaagtaaagtggcgggtgcgggtgtatgcgtggtgcgtcctccggga
catcacgcggacgcggatattctgtacatttcgatacatcgttacgacaacggtaccttc
ttccctcactcgaaggacgcagactacggggcagtgggggagggggcgggggaggggtac
aatgtcaatattccctggaataagcgtggaatgggtaacgcggagtacatggcggcgttc
acacaagtggtgctgcccattgcctatgaatacaatccggagctggtcattgtctccgca
ggatttgacgcctgtatcaatgatccattaggcggttgcaaagtgttaccagaatgctac
ggacggatgacacaaatgttgaaaggattagcgggaggcaaaattatcctctgcttagag
ggcggatataatatagtgagcacttcgtacgctatgacaatgtgcacaaaagccttactc
ggagaccccatagagttcaattacaacccagaagaagaaatccactggtccgccgtagaa
actataaataacgtcatcaaaacacaaaagaaatattggaaaagtctcaaattccaatta
gcgctaccgataaagaacgttctagacaaaccttcaccttctagaggtttaattgtcagc
actccagtaccgcaaaagtcactgtcatcaaatgtcacttctaaatcatccaatggtctg
caatcattggaaagtgatatgatgaatttgaccataaacaaatgtgcagatggtatacac
tgtggtacagatgacgaagacgataacggtacagatacaaatgcgggttgttcgaaatct
tcaggtgagggtagttctaaaactgtctcagacaaaggtaacaaagagagtgagaaacaa
actcttgtggattatttatcagagaatatgcaggctcttgttgatggggagatgtttgca
gtggtgccagtgccgtggtgcccacatttagatactctgttcgctataccagagtcggtt
aagtttgaacaaggcgttaaatgtgtggattgcgaagagaagaatgagaattgggtgtgt
ctgcattgttatattactgcatgcggtcgcagtataaacgggcacatgcaagcgcaccac
agagcaactcaacacccgttagtcctctccctcctcgacctgtccgtgtggtgtaacatt
tgcgacgcgtacgtcgacaacccactgctctatgacgctaagaacaacgcacataaatgt
aaattcggcgaagacatgccatggtgttataaaacagatatacatatggcataa

DBGET integrated database retrieval system