KEGG   Papilio machaon (common yellow swallowtail): 106716199Help
Entry
106716199         CDS       T05138                                 

Definition
(RefSeq) angiotensin-converting enzyme-like isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106716199
Peptidases [BR:pmac01002]
 Metallo Peptidases
  Family M2
   106716199
Exosome [BR:pmac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106716199
CD molecules [BR:pmac04090]
 Proteins
  106716199
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 106716199
NCBI-ProteinID: XP_014365153
LinkDB All DBs
Position
Unknown
AA seq 645 aa AA seqDB search
MSKVKTMLKIGGGALLIAAIVAVFVVATQGRDPDLEALEHEGREYILQLDRAAGIRKNRA
SVAEWAYTSNITKENEEQRIQVQLELSKQDKQSWEETKMYKWQDFQDFTLRRMFKKYSQL
GVSALPDDKYKLLMQSVSGMESNYATSKICSYKNATKCDLALEPDITELFAKSQDPEELR
HLWVEWHRAAGARARDNFTLYVQLDNEAAKLNDFKDVAEWWQAEYEVADFEAQLAQLWED
VKPLYQQLHAYVRRRLRDKYGDQVVSQKGPIPAHLLGNMWAQTWNNIESFTRPYPDKKEV
DITQAMQEQNYTALKMFQMSDEFFRSLNLTAMPEKFWNNSIIEKPTDREIVCHASAWDFY
DGEDFRIKQCTTIDYEYFQTTHHEMGHIQYFLQYKHQPVIFRDGANPGFHEAVGDTIALS
VSSPKHLRRVGLVSGDAEDEQTEINQLYKMGIDKIVFLPFAYTLDLFRYGVFRGETRPED
YNCHYWRLREALQGVEPPVNRTEEHFDAAAKYHVSADVEYARYYVSFIIQFQFHRALCQL
AGEYVPEDLTKKLVDCDIYQSVAAGNALANMLKMGSSRAWPDAMEALTGQRAMRADGLLE
YFRPLHDWLRAENQRTGEHIGWEPSKIQYCTSEQRAALEADARDS
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagtcaagactatgttgaagatcggtggaggggcgttgctaattgcggcgata
gtggcagtgttcgtggtggcgacgcagggccgcgaccccgaccttgaggccctggagcat
gaaggccgcgagtacatcctgcagctcgaccgcgcagctggtataagaaagaaccgcgcg
agtgtcgccgagtgggcgtacacttctaatattaccaaggaaaatgaagagcagcggata
caagtacaattagaattgtcgaagcaagacaagcagtcgtgggaggaaacaaagatgtac
aaatggcaggacttccaagactttacgctgaggagaatgttcaagaagtacagtcagttg
ggcgtgtccgcgctccctgacgacaaatacaagttgctaatgcagtccgtctcgggaatg
gagtccaattatgctacttctaagatttgctcatacaagaatgcaaccaaatgcgatttg
gctttagagcctgatataacggagttatttgcgaaaagccaggaccccgaagagcttcgt
cacttgtgggtggagtggcaccgcgcagcgggggcacgcgcccgcgacaacttcacgctg
tacgttcagctcgacaatgaggccgccaaacttaacgatttcaaagacgtggcggagtgg
tggcaggcggagtacgaggtggcggacttcgaggcgcagctggcgcagctgtgggaggac
gtgaagccgctgtaccagcagctgcacgcgtatgtgcgccgtcgcctgcgcgacaagtac
ggcgaccaggtcgtctcccaaaagggacctattcccgcgcatcttttaggtaacatgtgg
gctcaaacttggaacaacatagagtcgttcactcgtccctaccctgacaagaaggaggtg
gatataactcaggcgatgcaggaacaaaactacacagctctcaagatgttccaaatgtcc
gatgagttcttcagatcgttgaacctgacggcaatgccagaaaagttttggaataattct
atcatagagaaaccaactgacagagagatcgtgtgtcatgcttcggcttgggacttttat
gacggagaagattttaggatcaaacagtgcacgactatagattatgaatatttccaaacg
acacatcacgaaatggggcacattcagtacttcttacagtacaaacatcaaccagttata
ttccgggacggagctaacccaggtttccacgaggcggtgggcgacacgatcgcgttgtcg
gtgtcgtcgccaaagcacttgcgtcgtgtcggcctcgttagtggagatgcggaggacgaa
cagactgaaatcaatcaactttataaaatgggcatagacaagatcgtgttcctgccgttc
gcgtacacgttggacctgttccgttacggcgtgttccgcggcgagacgcggccggaggac
tacaactgccactactggcgactgcgcgaggcgctgcaaggtgtggagccgccggtcaac
cgcactgaggaacactttgatgcagccgccaagtaccacgtctccgctgatgtggagtac
gccagatactacgtgtcgttcatcatccagttccagttccaccgcgcgctgtgtcagctg
gcgggagagtacgtacccgaggacctcaccaagaagctcgtcgattgcgacatctaccag
agtgtggccgccgggaacgcactcgctaacatgttgaagatgggctcgtcccgggcgtgg
cccgacgcgatggaggcgctgacggggcagcgcgcgatgcgggcagacggactgctggag
tacttcaggccgctgcacgactggctccgagctgagaaccagaggactggagagcacatc
ggatgggaacctagcaaaatacagtactgcaccagcgagcagcgagcggcgctggaggcg
gacgcgcgcgactcgtga

DBGET integrated database retrieval system