KEGG   Papilio machaon (common yellow swallowtail): 106718842Help
Entry
106718842         CDS       T05138                                 

Definition
(RefSeq) DNA repair protein complementing XP-G cells
  KO
K10846  DNA excision repair protein ERCC-5
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    106718842
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pmac03400]
    106718842
DNA repair and recombination proteins [BR:pmac03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106718842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: XPG_N XPG_I UIM Mob1_phocein Transposase_20 5_3_exonuc HHH
Motif
Other DBs
NCBI-GeneID: 106718842
NCBI-ProteinID: XP_014368523
UniProt: A0A0N0PB12
LinkDB All DBs
Position
Unknown
AA seq 1110 aa AA seqDB search
MGVTGLWRLIEPAGKPVPVETLENKVLAVDISIWLHQMVKGYQDAKGAPVANAHLMGLFQ
RLCKLLYFRIKPVFVFDGGYPDLKKETIAKRQDNKSKLNSESERLKRELALLLGKRTAIG
SLLGKQISPKKANPATDVNRDDMFKLPALPQKEEESETESEDEQDSSASTVDLHTVDVES
ENFKSMPAKEKYDLLIELKETRKMNSWGKLHTLPKKSDQFSDFQMERLLKRRKIQECLEE
TEKEMGDGTMSINELESLLNEEGIDTKIETLPTRRIASNNTTRFLLINNVKQALADAKKK
KELLSKKEEVDKKIVPEEVTNVTPKTEDEELQMAIKMSMECVDDINTSAGTSKTDDSWTS
HLSDSDYSYSYSEDEGDDIEQPDMSSAKAYIAQYSDFTYKAIDNIVTSKNSGSKSKCKVP
KIDEIIKELENEKSIIVDKVDLSSDEDKKLHDIKLIDPDTQTQNENNLIADIDVNDTQQS
VIAVENQSISVINLDTSTEEEKSEVKTIVSDSVNVGTVQNELSDDSSDNEFEEVPEENKS
SKPVVELTLNMGAAPDDDIFADVFEDNKQEHIKENQENKNEPTVLNTNIDLCEIKIKEEP
DKSEIYDIDTEKDITASPKIDTSPIEKESSGEDEQNDAAVNAENVNKSNEQKDIELSPEK
TDHTVIESNKPPKKLLTTEDLNSMMTEIQSKEDHLMQEKGKMDRIGRNITEEMTKDAQEL
LQIFGIPYIVAPMEAEAQCAFLERVNLTDGTITDDSDIWLFGGKTVYKNFFNHKKHVMQF
LSERIEKSFNLSREQLILFALLVGSDYTMGIPGIGPVTALEILASFPFSKRQFLSETSKQ
AKYFQIIAGLQEFKKWVRAGKRTDNIKLKKKIKNVQLTEDFPSMRVVQAYLEPNVEESDE
KFTWGNIDITILRDYTKTKFGWSQNKLDEIIKPVLSRINDRKTQRSVQDYFKAKIDFQSL
EDKMSKRVKAAVQMMDPEYKAEVNEEDIQPVGEDKKGKIKRKPNKVTMGNDLSEPSTSKK
KKSENNEAVTKVININEANCQGFEVVIPKTDRFQEIIPQREKDKQNILQNKLKAIEIFRK
SKISRKVKRTKRRVNLPKAEAELSESSDEN
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgggagtcactggactgtggagacttattgagcccgcaggcaaaccggtcccggtggag
actttggaaaacaaagtgctcgcagttgatatatcaatatggttgcatcagatggtcaaa
ggataccaagatgcaaaaggagcccctgtggcaaacgctcaccttatgggtctatttcaa
cgtctctgtaaattactttactttagaataaaaccagtatttgtttttgatggtggatac
cctgatttaaaaaaagaaacaattgctaagagacaagataataaatctaaacttaattcc
gaatcagaaagattaaaaagagaacttgccctattgcttgggaaaaggacagctattggt
agtttattgggaaagcaaatatctccgaagaaagccaaccctgcaactgatgtaaataga
gatgatatgtttaaactgccagctttgcctcagaaagaagaagaatctgagacagagtct
gaagatgaacaagattctagtgcatctacagttgacttacacacagttgatgttgaatct
gagaattttaaaagtatgcctgctaaagaaaagtatgatttactcattgaattaaaagaa
acaagaaagatgaattcatggggaaaacttcatacactgccaaagaaaagtgatcagttc
tcagattttcaaatggaaagattattaaaacgtagaaaaatacaagaatgtttagaagaa
acggagaaagaaatgggagatggcacaatgtctataaatgagcttgaatctttgttaaat
gaagaaggtattgatacaaaaattgaaacactacccactcgccgaatcgcctctaataat
actacaaggttcttactcatcaataatgtaaaacaagcattagcagatgctaaaaagaaa
aaagaactacttagtaaaaaagaagaagtagataagaaaattgttcctgaagaagtgact
aatgtaacaccaaaaacagaagatgaggaacttcaaatggcaataaaaatgtcaatggaa
tgtgtagacgacattaatacaagtgctggtacatctaaaacagatgattcttggacttca
catttgtcagactctgattattcttattcctattctgaggatgaaggtgatgatattgaa
cagccagatatgtcctctgccaaggcctatattgcacaatatagtgactttacctataaa
gctattgataacattgtaacatccaaaaatagtggctccaaaagtaaatgcaaagtccca
aaaatagatgaaataatcaaggaacttgaaaatgaaaagtcaattatagttgataaagtt
gatttgtcatcagatgaagacaaaaaattgcatgatattaaactcatagacccagatacc
cagacccagaatgaaaataatttaattgctgatattgacgtaaatgatacacagcaatct
gttattgctgttgaaaaccaatctattagtgtaataaacctcgacacaagcactgaagag
gaaaaatcagaagtaaagactattgtatccgactccgttaatgttggaactgttcaaaac
gaattatcagatgattctagtgacaatgaatttgaagaagtgccagaagaaaacaaatca
agcaagccagttgttgagctcactctcaacatgggggccgctcctgatgatgatatattt
gctgacgtttttgaagacaacaaacaagaacacattaaggaaaatcaagaaaataaaaat
gaacctacagtcttaaatactaatattgatttgtgtgaaataaagataaaagaagagcct
gataagtccgaaatttatgacatagatacagaaaaagacataactgcgtctccgaaaata
gatacatcgcctattgagaaagaaagctctggtgaagatgaacagaatgatgcagcagta
aatgcagaaaatgtaaataaaagcaatgagcaaaaagatattgaattatccccagaaaaa
actgatcatactgtcattgaaagtaataagccacctaagaagttattaactactgaagat
ttaaattccatgatgaccgaaattcaaagcaaagaggatcatttgatgcaagaaaaagga
aaaatggatcgaatcggaagaaacataacagaggaaatgacaaaagatgcgcaagagttg
cttcaaatttttggtattccttacatcgttgctccgatggaggcagaagctcaatgtgca
tttcttgaacgtgtaaatttaacagatgggactataacagatgatagtgatatttggtta
tttggtggaaagacagtgtataagaatttctttaatcacaagaaacatgtgatgcagttt
ttgtcagaaagaatagagaagtcatttaatttatcaagagaacagttaatactgtttgcg
ttgttagttggtagtgattacacaatgggtatacctggtattggtcctgtaactgcgcta
gaaatcctagcatcctttccattcagcaagaggcagttcctcagtgagacatcaaaacag
gcgaagtattttcaaataatagctggtttacaagaattcaagaaatgggtgcgagcagga
aagagaacggataatattaaactaaagaaaaagataaaaaatgttcaactaacagaggat
tttcctagtatgagggtggttcaagcttacctagagccgaatgttgaagaaagtgatgaa
aagtttacttggggaaatattgatattactatattacgagattatacaaaaactaaattt
ggctggtcacagaataaacttgatgaaattataaaaccagttttgagcagaataaatgat
cgcaaaactcaaagatcggttcaggactatttcaaggcaaagatagattttcagtcactc
gaggataagatgagtaagagagttaaagccgcggttcaaatgatggacccggaatataag
gcagaagtaaatgaagaagatattcaacctgtaggagaagacaaaaaaggaaaaataaaa
cgaaaaccaaataaagttacaatgggtaatgacctgtcagaaccatcaacaagtaaaaag
aagaaatctgagaataatgaagcagtaactaaagttattaatattaatgaagccaattgc
caaggttttgaagttgtcattccgaaaactgacagattccaagagatcatacctcagaga
gaaaaagacaaacagaacattttacagaataagttgaaagcaatagagatatttagaaaa
tctaaaatcagtagaaaagttaagcgcacgaaaaggagagtaaatctaccaaaagccgaa
gccgagctatcagaaagtagcgatgaaaattag

DBGET integrated database retrieval system