KEGG   Papilio machaon (common yellow swallowtail): 106718904Help
Entry
106718904         CDS       T05138                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Pathway
pmac00052  Galactose metabolism
pmac00500  Starch and sucrose metabolism
pmac01100  Metabolic pathways
pmac04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106718904
   00500 Starch and sucrose metabolism
    106718904
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106718904
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmac04147]
    106718904
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106718904
Exosome [BR:pmac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106718904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 PXA NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106718904
NCBI-ProteinID: XP_014368592
LinkDB All DBs
Position
Unknown
AA seq 1238 aa AA seqDB search
MLGVGLMCVLCVAVWLVVGGTLGGAWTEDKYRKLWQRVHPENTERPMTYYEMVVPEVHYH
DHNNLSTKNKFNGSEGSRKTPLDDEKYQRLMRPKPIQVPTEAPETAKYLKRTPEMLRNMC
SNVTDNMRFDCYPQTGANEEACLKRGCCWKSTSIQGAPYCFYPPNYDTYKFYNMTENKRG
VTAYYALNRPSGYPGDFRMVRVDIMFVTGDIINAKISDAENPRFEAQYPEIPMVYGSIKT
MKYKMVLESSSIGFKVVRLSDNVTVFNTQNIGGLILSDKFLQISSLLPTNQIYGLGERRA
RFRTVLNEWKTFTMFNSDQAPVENTNLYGTQPFYLALEPDGKAHGTLLLNSHAIDVVLQP
TPAITYRTIGGLFNFYMFLGPSPGDVVSQLTEIIGKPFMPPYWALGFHLCKYNYGSLQVT
RDVWKSNRDAGIPLDVQWNDLDYMKNGNDFTYDDVKFKGLPEFVKELHEAGMHYMVLFDP
GVSAAEKAGTYPPFDKGLEMNVFIKNSTGQPFVGKVWNKVSTVWPDFTHPNATMYWTQMM
SNFHKKIPYDGAWIDMNEPSNFVSGSLYGECAPEELPYTPHYLTNGLKHKTLCMDAHHYA
GDHYNWHNLYGLTEAIATHFALVEIRGSRPFIISRASFPGLGRYAGHWSGDVDSSWHDLR
MSIPELLSFSLFGIPMMGADICGFRGNTTVELCKRWMQLGAFYPFSRNHNSDSSIPQDPV
SLGAEVVSSSRTALRMRYSLLPYYYTLFWRAHLHGELVARPLYFEXVIFKYLIVIGGHRN
EGDDIIGPYLLISPILWPGTNNTRAYFPAGYWYSLDGTLLTSGWRNVTEQHMLAVKGGGI
LPLQEPPEGVVSTRECRARPLHVLAAPDXAAQARAILYWDDGLGLQTYDESKYSLVHFIL
DKQEFRSELQWWAYGMPTVNKITIFGQKVPIKNVTINQKPCKKPNCEFSYSSNSKIFGCE
TCGSKDCSRHNPDVAPEPWSGLLIHKQLDQAIEDFYNAILDQFINTWYSKITLQPFFIDE
LRLQLRYASANLLKRALKIDYARLITERLVPCALRHHAVISSGAKPALHVAACNRAAEMK
YLRSLTEVLLPLVLQPNETNNSVFRVLVRELFAGWVLLSLTDVLADPYILNALIILATSD
ETMSELPTTPNYKVEFLETFTRQTECVYTARCRLLQLDVETVLSQQEQLYALMQHLKTTG
HLQLLQFYKDISKTLIAIGSIVIMVDQSLHLFALLFVI
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtgttgggttaatgtgcgtgctctgtgtcgccgtgtggctggtggtaggaggg
actttaggtggtgcctggactgaggataagtacagaaaattatggcagcgagtccaccct
gaaaacacagagagacctatgacatactatgaaatggttgtaccagaagttcattaccat
gatcataacaacttaagcacaaagaacaagttcaatggttccgaaggttctagaaagaca
ccattagacgacgagaaataccaacgcttgatgcggcccaagccaatacaagtacccact
gaggcaccagagactgccaagtacttgaagagaaccccagagatgctccggaatatgtgc
tcgaatgtgacagataatatgcgcttcgattgttaccctcaaacgggtgcgaatgaagaa
gcttgtttgaaaagaggttgttgttggaaatcaactagcatacaaggcgcaccatactgc
ttctatccacctaactacgacacatacaagttctataatatgactgagaataaacgcggc
gtaaccgcgtactacgcgctgaaccgcccctccggttacccgggtgacttccgtatggtc
cgcgttgacatcatgtttgtaactggcgatatcatcaatgctaagatatctgatgcagaa
aatccaaggtttgaagcacagtacccggagatcccaatggtgtatggttccatcaagaca
atgaagtacaaaatggtgctagagagttcaagtattggattcaaagttgttcgcctctct
gataatgtcactgtatttaatacacaaaatataggtggattgatattatcagataagttt
ctgcagatatcatcactgctgcccaccaatcagatatacggtctcggtgagagacgggcc
aggttcagaactgtattgaacgagtggaaaactttcactatgtttaactctgatcaagct
ccagttgaaaatacaaacttgtacggtacacagcctttttatttagctctggaaccggac
ggcaaggcgcatggcactctgttgttaaattcacatgctatagatgtggtgctgcagcca
acaccggctataacctaccgtactatcggtggtttgttcaatttctacatgttcctgggc
ccctcgcccggtgatgttgtgtcacagcttacagagatcatcggcaaaccatttatgcct
ccgtactgggcattgggattccatctttgcaagtataactatggcagtctacaagttacc
agagatgtatggaagagtaatagagatgcgggaatcccattggacgttcagtggaacgat
ttggattatatgaaaaatggaaatgactttacatacgacgatgtcaaattcaaaggtcta
ccggagttcgtgaaagagttgcatgaagctgggatgcattatatggtgttgtttgatccc
ggggtgagcgctgcagagaaagctgggacttacccgccttttgacaagggccttgaaatg
aatgtgttcattaagaattctacgggacaaccttttgttggaaaggtgtggaataaagtg
tcaacagtatggccggactttacgcaccccaatgccaccatgtactggactcaaatgatg
tcaaactttcacaagaaaataccatacgatggcgcttggatcgatatgaatgaaccatca
aactttgtgtccggttctctgtacggtgaatgtgcacctgaagaacttccttacacacct
cattatctcaccaatggtttgaaacacaagactctatgtatggacgcacatcattacgcc
ggtgatcattacaactggcacaatctctacggactcactgaagctatcgccactcacttt
gcgttagtcgagatccggggaagtcgtccgtttataatatcgcgggcgtctttccccgga
ctgggaaggtacgcgggacactggagtggagatgttgacagcagctggcatgatcttagg
atgagcataccagaattgctaagtttcagtctatttggtatacctatgatgggtgcggat
atttgtggtttccgaggcaacaccacagttgagttgtgtaagagatggatgcaactcggt
gctttctatccattctctaggaatcataactctgattcgtctattccacaagatcctgtg
agtttgggtgcggaggttgtatcctcgtctcgtacagcgctgcgcatgcgctactctctg
ctgccatattactatacgttattctggcgcgcacatctacatggagagttagttgctaga
cctctgtactttgagtgagttatatttaagtatttaattgtcataggtgggcacagaaat
gaaggggacgatataattggaccgtatctattgatatctcctatactatggcctggtacg
aataataccagagcgtacttccccgctggctactggtacagccttgatggtacactactg
acatccggctggaggaatgtcacagaacaacatatgctcgctgtcaagggtggtggcatc
ctgcctctacaagagccgccagagggcgtggtgtcaacgcgtgagtgtcgcgcgcgccct
ctacatgtgttggccgcacctgacnntgcagcacaggctagagctatactatactgggac
gatggacttggactacagacatatgatgaaagtaaatacagtttagtacatttcatattg
gacaaacaagagttccgaagtgaactacaatggtgggcatacggtatgcccactgtcaac
aaaataaccatctttggacaaaaggtgccaatcaaaaatgtcacaatcaaccaaaaaccc
tgcaagaaaccaaactgcgagttctcctattcaagtaattctaaaatatttggttgtgag
acatgtggatccaaagattgttcccgccataatccagacgtagctccagagccatggagt
gggctacttatacataaacaattggaccaagccattgaagatttctacaatgctatatta
gatcaatttataaacacatggtacagtaagataactctacagccattttttattgatgag
ttgaggctacaattgagatatgcatctgctaatttgttgaaaagagctttgaagatagac
tatgcccgtcttatcacggagcggttagtgccatgtgcactacgtcatcatgcggtgata
tctagtggtgcaaaaccagctctccacgtagctgcctgcaaccgcgccgctgagatgaag
tacttaagatcgttgaccgaagtcttgcttccactggtactgcaacctaatgagacgaat
aactctgtattccgagtgctggtccgtgagttgtttgcaggctgggtgttattgtcacta
acagatgttttagctgacccgtacatattgaacgctcttatcatattagcaactagcgat
gaaactatgtcagaactaccaactacaccgaactataaagtggaattcctggagacattc
acccggcagactgagtgcgtgtatactgctcgctgcagactgctgcagctggatgtggag
acggtgctgtcgcagcaggagcagctgtacgctctcatgcagcatctgaagaccaccgga
catctgcagctgctgcagttctacaaggatatcagtaagactcttatagcaattgggtcc
attgttataatggtggaccaatctttacatcttttcgcactgctgtttgtgatataa

DBGET integrated database retrieval system