KEGG   Papilio machaon (common yellow swallowtail): 106719653Help
Entry
106719653         CDS       T05138                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit gamma-1-like
Organism
pmac  Papilio machaon (common yellow swallowtail)
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 106719653
NCBI-ProteinID: XP_014369526
LinkDB All DBs
Position
Unknown
AA seq 70 aa AA seqDB search
MDMMVSTLQQQRAVTEQLRREAAIKRIPVSVAVADIVRYIDDHEHEDCLLVGFSSQKVNP
FREKSSCTVL
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atggacatgatggtatcgactttgcaacagcagcgtgctgtcacggaacagcttagacga
gaagctgctattaaacgtattcccgtttccgtggcagtggcagatatcgtcagatacatt
gacgatcatgagcacgaggactgtttacttgtcggcttttccagtcaaaaagtcaatccc
ttccgtgaaaaaagttcttgcactgtactctaa

DBGET integrated database retrieval system