KEGG   Papilio machaon (common yellow swallowtail): 106720249Help
Entry
106720249         CDS       T05138                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pmac  Papilio machaon (common yellow swallowtail)
Brite
KEGG Orthology (KO) [BR:pmac00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pmac01002]
    106720249
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmac04147]
    106720249
   04090 CD Molecules [BR:pmac04090]
    106720249
Enzymes [BR:pmac01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106720249
Peptidases [BR:pmac01002]
 Metallo Peptidases
  Family M2
   106720249
Exosome [BR:pmac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106720249
CD molecules [BR:pmac04090]
 Proteins
  106720249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Myb_DNA-bind_5
Motif
Other DBs
NCBI-GeneID: 106720249
NCBI-ProteinID: XP_014370333
LinkDB All DBs
Position
Unknown
AA seq 816 aa AA seqDB search
MACAHERKFIRTWFIFVLLPSCFADPQLDLPPLPQISSTPRNPYGGYGLLSSTPSINSPG
NQYDIQNRNFQYSTARPISTSTAGIYPVSTTPFNGRINPDISNNGYPSLDYGNGRNPSST
LRPYDVNRDDRIDVNNDPNFRRNDPNFARNDPNFAGASPYDFNRDGNFNTIEDRYHRVNL
QQVRDFLVRADEQASKECTNNVAAQWNFETDVNDATQHAALDAQQRYTLFQRGLWEAAKQ
IPRDSIRDFGTYRQLQLLSTIGAAALPPDQLDRYNRIINDMLAVYNTAEICAYNEPFKCG
LHLQPQLQEIMSHSRDWDELQHVWTEWRRNTGRRIRDLYEQLVDLTNQAARLNNFTDASA
YWMFPYETINMRQEIEEVWEQIKPLYELLHAYVRRRLREAFGPERISRSAPIPAHVLGDM
WGQSWSGIVPYTLPYPGKNLVDVSKEMIQQGYTPLTIFQLAEEFFVSMNMSAMPPDFWAL
SVLEQPVDRHVHCQPSAWDFCNRHDYRIKMCTHPNMKDLITAHHEMAHVEYFLAYRNQPK
VFRDGANPGFHEAIGETIALSVASPRHLQTLGLVQKSIDDTAHDINYLFTQAMDKLAFLP
FALVMDKWRWDVFTGDIRKEQYNCHWWRLREQYQGVKPPVLRSEMDFDPGSKYHIPANIP
YIRYFVSTVLQFQIHRALCTRTGQYIPGEPTRPLHKCDIYRNPEAGRILKRLMERGSSAP
WMQVLQDSIGEGRLSGEALREYFRPLEEWLHSENLRTGEYLGWSYDGDYCKFSIETAGLQ
VYGGFYNAAVRHYDVTSFITLLMTSFLATVYSLHTR
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcgcccacgagagaaaatttatcaggacatggttcatctttgtgttgttacca
tcgtgtttcgccgatcctcagttggatttgccgccgttgcctcaaatatcgagtactcca
cgcaacccttacggaggctacggtctactatctagtactccatcaattaatagtcccgga
aatcaatatgacatacaaaataggaatttccaatacagcactgcgagaccaataagtact
agcacagcaggaatctacccggtttccacgaccccattcaacggtaggattaatccggat
ataagcaacaatggatatccgagcttagattatggtaacggacgtaatcccagttcgact
ttacgaccgtacgatgtcaacagggatgaccgcatagatgttaataacgatccaaatttc
agacgcaatgatcctaattttgctcggaacgatccaaattttgccggagcgagtccgtat
gattttaacagggacggaaactttaatactattgaagatagatatcatagagtgaatttg
cagcaagtgagagatttcttggtgcgagctgatgaacaggcttcgaaggaatgcaccaac
aacgttgccgcgcaatggaatttcgaaactgatgtcaatgatgcaactcaacatgccgca
ttggatgcgcagcagcggtacacattgtttcagcgcgggctttgggaggcggctaagcag
atcccgcgggacagcatccgggacttcggcacataccgtcaattgcaattactctccacc
attggagcagccgcgcttccaccggaccagctagaccgatacaatcgtataatcaatgac
atgctggcggtgtacaacacagcggagatctgcgcgtacaacgagccatttaagtgcggc
ttacacctacagccgcagttacaggagatcatgtcgcactcccgcgactgggacgagctg
cagcacgtctggaccgagtggaggaggaacacgggcagaaggatacgtgatttgtatgag
caactcgttgatctaacaaatcaggctgcgaggttgaataatttcaccgatgcttctgct
tattggatgtttccctacgagacgataaacatgagacaagaaatcgaagaagtttgggaa
cagattaaaccactttatgagttactccatgcatacgtccgtcgtcgtctccgggaagcc
ttcggccccgagaggatctccaggtcggcgccaatccccgctcatgtcctaggagatatg
tggggacagagctggtccgggattgtgccctacaccctgccttatccagggaagaactta
gtcgatgtcagcaaagaaatgattcaacagggctacacaccactaacgatcttccagttg
gcagaggagttctttgtgtcaatgaacatgtcagcgatgccgccggacttctgggcgctt
agcgtactcgagcagcccgtggatcgccacgtgcattgccagccctccgcatgggacttt
tgtaaccgacatgactatcgtatcaagatgtgcactcatccaaacatgaaggacttgatc
accgctcaccacgagatggcgcacgtagagtacttcctggcctacaggaaccagcccaag
gtcttccgcgacggagctaatccaggtttccacgaagctattggcgagacaatcgccctc
tcagtggcctctcctcgtcacctgcagacgctgggcctggtacagaagtccatcgacgac
acggcgcacgatatcaactacttgtttacccaagctatggacaagctggccttcttaccc
ttcgcattggtgatggacaagtggcgttgggatgtgttcactggtgatatcaggaaggaa
cagtacaattgtcattggtggcgactcagggaacagtatcaaggtgtgaagccgccagtt
cttcgttcagaaatggacttcgatcccggttccaagtaccacattcctgctaatataccc
tatataagatacttcgtgagcaccgtgctgcagttccagattcaccgggcgctgtgcacg
cgcacgggtcagtacatccccggagagccaacgcgaccgctacacaagtgcgacatctac
cggaatccggaagctggcaggatactcaagcgtttgatggagcggggttcctccgcaccg
tggatgcaggttctgcaggatagcatcggagagggacggttgagcggggaggcgttgcgg
gagtacttccgaccgctcgaggagtggctgcatagcgagaacctgcgtacgggcgagtac
ctcggatggagctacgacggagattattgcaaattcagtattgagacagcaggcttacaa
gtttacggcggattctacaacgcggctgtccgacattatgacgtcacaagctttataacc
ttacttatgacgtcattcctcgccacagtatacagccttcatacacgataa

DBGET integrated database retrieval system