KEGG   Prauserella marina: BAY61_03335Help
Entry
BAY61_03335       CDS       T04988                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pmad  Prauserella marina
Pathway
pmad00020  Citrate cycle (TCA cycle)
pmad00480  Glutathione metabolism
pmad01100  Metabolic pathways
pmad01110  Biosynthesis of secondary metabolites
pmad01120  Microbial metabolism in diverse environments
pmad01130  Biosynthesis of antibiotics
pmad01200  Carbon metabolism
pmad01210  2-Oxocarboxylic acid metabolism
pmad01230  Biosynthesis of amino acids
Module
pmad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmad_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAY61_03335
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BAY61_03335
Enzymes [BR:pmad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BAY61_03335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASR34185
UniProt: A0A222VJU4
LinkDB All DBs
Position
761576..762799
Genome map
AA seq 407 aa AA seqDB search
MAKIKVEGTVVELDGDEMTRIIWQFIKDKLVHPYLDVNLEYYDLGIEERDRTDDQITVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIVISNIPRL
VPGWTKPVIVGRHAHGDQYKATDFKVPGPGTVTMTYTPADGSEPMEFEVANFPEGGGVAM
GMYNYRRSIEDFARASLQYGLDRGFPVYMSTKNTILKYYDGMFKDVFQEIFDAEFKADFD
AKGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLRTPDG
RTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDGNSELVGFATKLE
QVVIETVESGKMTKDLALLVGKEQPFQTTEDFLATLDENLAKKIAQG
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtcgagggcaccgtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctggttcacccgtacctggacgtcaatctggag
tactacgacctcggtatcgaggaacgggaccggaccgacgaccagatcacggtcgacgcg
gccaacgccatcaagaagcacggcgtcggcgtgaagtgcgccaccatcactcctgatgag
gccagggtcgaagaattcggcctgaagaagatgtggcgcagccccaacgggacgatcagg
aacatcctcggcggcgtgatcttccgtgagccgatcgtcatctccaacattccgcgactg
gtgccgggctggaccaagccggtcatcgtgggcaggcacgcgcacggcgaccagtacaag
gccaccgacttcaaggtccccggccccggaacggtcaccatgacctacaccccggccgac
ggttcggagccgatggagttcgaggtcgcgaacttccccgagggcggcggcgtcgccatg
gggatgtacaactaccggcggtccatcgaggacttcgcccgcgcatccctgcaatacggg
ctcgaccgtggtttcccggtctacatgtcgacgaagaacacgatcctcaagtactacgac
ggcatgttcaaggacgtgttccaggagatcttcgacgccgagttcaaggcggacttcgac
gcgaagggcctcacctacgagcaccggctgatcgacgacatggtcgccgcgtcgctcaag
tgggagggcggctacgtgtgggcctgcaagaactacgacggtgacgtgcagtccgacacc
gtcgcgcagggcttcggctcgctcggcctgatgacctccgtgctgcgcactcccgacggc
aggaccgtcgaggccgaggcagcccacggcaccgtcaccaggcactaccggcagcaccag
cagggcaagcccacctcgaccaacccgatcgcctcgatcttcgcgtggacgaggggtctt
gagcacaggggcaagctcgacggcaactcggagctggtcggcttcgccaccaagctggag
caggtcgtcatcgagaccgtcgagagcggcaagatgaccaaggacctcgccctgctggtc
ggcaaggagcagccgttccagaccaccgaggacttcctcgcgacgctggacgagaacctg
gcgaagaagatcgcccagggctga

DBGET integrated database retrieval system