KEGG   Prauserella marina: BAY61_05885Help
Entry
BAY61_05885       CDS       T04988                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
pmad  Prauserella marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_zinc_N_2 3HCDH_N NAD_binding_2 ApbA AlaDh_PNT_C FAD_binding_3 Shikimate_DH THF_DHG_CYH_C NAD_binding_7 F420_oxidored Pyr_redox NAD_binding_8 UDPG_MGDP_dh_N Pyr_redox_2 Methyltransf_25 Methyltransf_11 XdhC_C adh_short NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ASR34591
UniProt: A0A222VLK2
LinkDB All DBs
Position
1286534..1287553
Genome map
AA seq 339 aa AA seqDB search
MRAAIVDQPGTIRVGDVPDPKPAERQVVVKVGACGICGTDLHIADGHFPPTPYPIVPGHE
FAGEIVELGPGVPGDWRIGDRVAVDPSLFCGYCTPCRSGHGNLCANWGATGDTVDGAFAE
YVAVPSANCYRMPEGMTWQQGALVEPVSCAVHGVRRVGVEAGERFLVMGAGTMGLIMQQL
LQRAGASVTVVDRNTARLARATELGAVAVAGDAADLADEKFDAAADCTGAVPAIEAAFDA
LRRGGRLLVFGVAPEEARVALSPFRIYNDEITVVGSMAVLNSFGTALDLVAAGAVDTDAL
LTDTLSLERYPDALALMRSGAGLKVQVIPGGGNDAHTAR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgcgatcgtcgaccagccggggaccatcagggtgggtgatgtacccgacccc
aagcccgccgaacggcaggtcgtcgtcaaggtcggcgcgtgcggcatctgcggaaccgac
ctgcacatcgccgacgggcatttcccgccgaccccgtatccgatcgtccctgggcacgag
ttcgccggtgagatcgtcgaactcgggcctggtgtgcccggtgactggcggatcggtgac
cgggtcgccgtcgacccttcactgttctgcggctactgcactccgtgcaggtcaggtcac
ggcaacctgtgcgccaactggggcgccaccggggacaccgtcgacggagccttcgccgaa
tacgtcgccgtcccttcggccaactgctaccgcatgcccgaaggcatgacctggcagcaa
ggtgcgctcgtcgagcccgtctcctgcgcggtgcacggtgtcaggagggtcggcgtagag
gccggtgaacggttcctggtgatgggggcgggaacgatgggcctcatcatgcagcagttg
ctgcaacgggctggtgcctcggtgaccgtcgtcgaccgcaacaccgcgagactggccagg
gccaccgaactcggtgccgtcgccgtcgccggcgacgccgccgacctggccgacgagaag
ttcgacgccgcggccgactgcaccggcgccgtccccgccatcgaggcggccttcgacgcg
ttgcgcagagggggaaggctgttggtcttcggcgtcgcgcccgaagaggcgcgagtggcg
ctctcaccgtttcggatctacaacgacgagatcaccgtcgtcggctcgatggcggtactc
aacagtttcggcaccgcgctcgacctcgtcgcggcaggcgccgtcgacacggacgcgttg
ctcaccgacacgctttcgctcgaacgttatcccgacgcactggcgttgatgcgcagtggc
gccggactcaaggtccaagtgatcccgggaggcggcaacgatgcccacaccgctcggtag

DBGET integrated database retrieval system