KEGG   Prauserella marina: BAY61_09480Help
Entry
BAY61_09480       CDS       T04988                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pmad  Prauserella marina
Pathway
pmad00250  Alanine, aspartate and glutamate metabolism
pmad00410  beta-Alanine metabolism
pmad00640  Propanoate metabolism
pmad00650  Butanoate metabolism
pmad01100  Metabolic pathways
pmad01120  Microbial metabolism in diverse environments
Module
pmad_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BAY61_09480
   00650 Butanoate metabolism
    BAY61_09480
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BAY61_09480
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAY61_09480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmad01007]
    BAY61_09480
Enzymes [BR:pmad01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BAY61_09480
Amino acid related enzymes [BR:pmad01007]
 Aminotransferase (transaminase)
  Class III
   BAY61_09480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ASR35177
UniProt: A0A222VMQ1
LinkDB All DBs
Position
2066971..2068269
Genome map
AA seq 432 aa AA seqDB search
MTDADLLARHRAVLPGWLALYYAEPIEIVHAKGRHVTDSEGNTYLDFFAGILTNAIGYDI
DEISDAVRAQLDTGVLHTSTLYLIRKQVELAEQIAELSGIPGAKVFFTNSGTEANETALM
VATQYRRSNQILALRNSYHGRAFGTVGVTGNRGWSASSLSPVKVSFVHGGYRYRGPFASY
SDADYVAACVDDLTDVLATATSGDVAAMIAEPIQGVGGFATPPDGLFGAFKEVLEANGIL
LISDEVQTGWGRTGDHFWGIQAHGVTPDIMTFAKGIGNGLAIGGVIARADIMDCLPANSI
STFGGNPISTAGAKATLDYLLDNDLQGNAAKLGEHLSSGLRDIGSGYGIVGDVRGKGLMI
GVELVEKGGTAPNPAAATAVLEGTKARGLLVGKGGLHNNVLRLAPPMTLTDGEADEALGI
LHEAIASADAAD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcggacctgttggcccggcaccgggccgtgctgcccggctggctggccctg
tactacgcagaaccgatcgagatcgtccacgcgaagggacggcacgtcaccgattccgaa
ggcaacacctacctcgacttcttcgccggcatcctgaccaacgccatcggctacgacatc
gacgagatctccgacgccgtccgcgcgcaactcgacaccggcgtcctgcacacctcgacc
ctctacctcatccgcaaacaggtcgagctggccgagcagatcgcggaactgtcgggtatc
cccggcgccaaggtgttcttcaccaattcgggtaccgaggccaacgagaccgcgctgatg
gtggccacccagtaccgtcgcagcaaccagatcctcgccctgcgcaattcctaccacggc
agggctttcggcaccgtcggcgtaaccggaaaccgtggctggtcggcgagttcgctttcc
ccggtgaaggtgagtttcgtgcacggcggctaccgctaccgaggcccgttcgcgagctac
tccgacgccgactacgtcgccgcctgcgtcgacgacctcaccgacgttctcgcgacggcg
acctccggtgacgtcgccgccatgatcgcggagccgatccagggcgtcggcggattcgcg
accccaccggacggtttgttcggcgcgttcaaggaagtgttggaggccaacggaattctg
ctcatctcggacgaggtgcagaccggctgggggcggaccggcgaccacttctggggcatc
caggcgcacggcgtgacaccggacatcatgaccttcgcgaagggcatcggcaacggcctc
gcgatcggcggcgtcatcgcgcgagccgacatcatggactgcctccccgcgaattcgatc
tccacgttcggcggcaatccgatctccacggcgggtgcgaaggccacattggactatctg
ctcgacaacgacctccagggcaacgcggcgaagctcggcgagcacctgtcgtccgggttg
cgcgacatcggctccgggtacggcatcgtgggtgacgtgcgcggcaaggggctgatgatc
ggcgtcgagctggtcgagaagggcggcaccgcaccgaatccggccgccgccacggcggtg
ctcgaagggacgaaggcccgtggcctgctggtgggcaaggggggcctgcacaacaacgtg
ctcaggctggctccgcccatgaccctgaccgacggggaagccgacgaggcgctcggcatc
ctgcacgaggcgatcgcctcggccgacgccgccgactga

DBGET integrated database retrieval system