KEGG   Prauserella marina: BAY61_11360Help
Entry
BAY61_11360       CDS       T04988                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
pmad  Prauserella marina
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ASR35499
UniProt: A0A222VNL0
LinkDB All DBs
Position
complement(2472207..2473283)
Genome map
AA seq 358 aa AA seqDB search
MPLPVPRPLKPMLARAASRIPDSASLLFEPKWDGFRCIVFRDGDELTLQSRSLKPLNRYF
PEVVAELARTLPPQVVLDGELVVGVEGRLDFDALTERIHPAASRIALLSEATPARFVAFD
VLAIGERSLLDEPTSTRRDALTGLAESGLRRTPATTDPETARHWFALFEGAGLDGVVGKP
LEEPYQPGKRAMTKYKHSRTADCVVAGLRWHADTEPGEAVGSLLLGLHDEDGVLHHVGVV
GAFPATRRRELAAELAPLRTDGPHPWLGEAVVEGQRLPGGVNRWRPNEQPWIPLRPERVV
EVGYENTEGGHPSRLRHTARFVRWRPDRTPGSCDYAQLDQPARYDLDAVFHGEVKRTR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgccggttccgcgaccactcaagccgatgctcgcccgtgcggcctcccgcatc
cccgactcggcgagcctgttgttcgaaccgaagtgggacggcttccgctgcatcgtcttc
cgcgacggcgacgagctgactctccagtcgcgctcgctgaagccgttgaaccgctacttc
cccgaggtcgtcgccgaactcgcgcggacgctgccccctcaggtggtgctcgacggcgaa
ctggtggtcggcgtcgaggggcggctcgatttcgacgcgctgaccgaacggatccatccc
gcggccagccggatcgcgttgttgtcggaagccacgccggcccgcttcgtcgccttcgac
gtactcgccatcggcgaacggtcgttgctcgacgagccgacgagcacgcgcagggacgcc
ctgaccgggctggccgagagcgggttgcgcaggactccggccacgacggacccggagacg
gcccggcactggttcgcgttgttcgagggcgccggactcgacggcgtcgtcggcaaaccg
ctcgaagagccctaccagccgggcaaacgcgcgatgaccaagtacaagcactcgcgcacc
gccgactgcgtcgtcgcgggactgcgctggcacgccgacaccgaaccgggcgaggcggtg
ggctcgctgctactcggccttcacgacgaggacggcgtgctgcaccacgtcggcgtcgtc
ggcgcgtttcccgcgacgcggcgaagggaactggccgccgaactagcgccgctgcgcacc
gacggcccccatccgtggctcggcgaggccgtcgtcgaggggcagcggcttcctggcggg
gtgaaccggtggcggccgaacgagcaaccgtggataccgcttcgtcccgaacgggtcgtc
gaggtggggtacgagaacaccgagggcgggcatccctcgcgactgcggcacaccgcgagg
ttcgtgcgctggcggcccgaccgcacccccggctcgtgcgactacgcccagctcgaccag
ccggcgagatacgacctggacgccgtcttccacggcgaggtcaaacgcacccgctaa

DBGET integrated database retrieval system