KEGG   Prauserella marina: BAY61_14005Help
Entry
BAY61_14005       CDS       T04988                                 

Definition
(GenBank) hypothetical protein
  KO
K14949  serine/threonine-protein kinase PknG [EC:2.7.11.1]
Organism
pmad  Prauserella marina
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pmad01001]
    BAY61_14005
Enzymes [BR:pmad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BAY61_14005
Protein kinases [BR:pmad01001]
 Serine/threonine kinases: Other
  Bacterial family
   BAY61_14005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PknG_TPR Pkinase Pkinase_Tyr TPR_19
Motif
Other DBs
NCBI-ProteinID: ASR35935
UniProt: A0A222VPU1
LinkDB All DBs
Position
complement(3020419..3022482)
Genome map
AA seq 687 aa AA seqDB search
MPRHPTRPNTTTLAPDRFASREATTEELGGDLLGFPRLPRYDTAGAQLPFVEVPSPSGLV
EGAPADPEPALAPGTVLAGKYEVIGGLAHGGLGWVYLAKDIELDELYVALKGMIDPSDTK
LAEAERKTLTALNHPNIVRIFGFVLHRASAEREPDGYIVMEFVNGHSLRELLGRLGAGED
VFGEPLLAEHVIGYAQELLDALHYLHGQGLLYCDLKPDNIMHGGHRIKLIDLGATRKVGD
DTTPLAMTRRYQVGDSELAQHGVTVRSDLHTLGVTLGELLAVSDDDPAGETAFGVRSLRH
VIDRATAPFAQRFVSAADMAGALDGVLREIQSLRDGEPRPVPSALFAETPALFDVGLGAA
PPLERWTAAPAEDYSPPPLDDGRPSPADIALMLPPPLPDPADAGAGFLTEMRAPDARRRL
GQLAGWVENNGHTVELSLAQCRAHLEVGAPERARSWLDYATTTLGEDGEYDWRLGWHRGL
LALTRSDILEAEAEFFSVHRALAGEAAPKLALGYCAEHQGKPDVATDYYHAVWQRDRTQV
SAAFSLARLRLAEYDRAGAVAVLDQVPAVSLHYYAARIATVRVFVGDLGEGPPTSTDLVN
AFLRRPELNLEGDEENGGAGPARDRLDTEVYEAALHRAVKSGDGERRNAVGAQLEQCLRG
LARQARDAESQGVLIDLANTVRPKTWF
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
gtgcctcgccacccgacaaggccgaacacgacgacgctcgctcccgaccggttcgcctcg
cgcgaggccaccacggaggagctcggcggcgacctgctcgggtttccccggctaccgcgc
tacgacacggcaggggcgcagctgcccttcgtcgaggtgccttcgccgagcgggctcgtc
gaaggggcacccgccgaccccgaacccgcgcttgcccccggcaccgtgctcgcgggcaag
tacgaggtcatcggtggcctcgcccacggcggcctcggctgggtctacctagccaaggac
atcgagctcgacgagctgtacgtcgcgctgaaaggcatgatcgacccgtcggacacgaag
ctcgccgaggccgagcgcaagacgctgaccgcgctcaatcaccccaacatcgtgcgcatc
ttcgggttcgtactgcaccgcgcgtcggccgagcgggaaccggacggctacatcgtcatg
gagttcgtcaacggccactcgctcagggaattgctcggccgcctcggcgcgggcgaggac
gtgttcggggaaccgttgctggccgaacacgtcatcggctacgcgcaggaactcctcgac
gccctgcactacctccacggccagggactgctgtactgcgacctgaaaccggacaacatc
atgcacggcggtcaccggatcaagctcatcgatctcggcgcgaccaggaaggtcggcgac
gacaccactccgctcgcgatgacaaggcgttaccaggtcggcgattcggaactcgcgcaa
cacggcgtgaccgtgcgctccgacctgcacaccctcggcgtgacgctcggcgaactgctc
gccgtcagtgacgacgatcccgcgggtgagaccgcgttcggggtcaggtcgctgcggcac
gtgatcgacagggcgacggccccgttcgcccagcgcttcgtctcggcggccgacatggcg
ggcgcgctcgacggcgtcctgcgcgagatccagtcgctgcgcgacggcgagccaaggccc
gtcccttcggcgctgttcgccgaaacccccgcgctcttcgacgtcgggctgggggcagcg
ccgccactcgaacgctggacggccgctcccgccgaggactattccccgccgccgctggac
gacggccgcccctcccccgccgacatcgcgctgatgctgccacctccgctaccggaccct
gccgacgcgggcgccggattcctcaccgagatgcgcgcgcccgacgcccgcaggaggctc
ggccagctcgcgggatgggtcgagaacaacggccacaccgtcgagttgtcgctcgcgcag
tgcagagcgcacctcgaagtcggagcgccggagcgggcacggtcgtggctcgactacgcc
acgacgacgctcggtgaggacggcgagtacgactggcgcctcggctggcatcgcggactg
ctcgcgctcacccggtccgacatcctcgaagccgaggccgagttcttctcggtccaccgc
gcgcttgccggtgaggccgcgcccaagctcgcgctcggctactgcgcggagcaccagggc
aaacccgacgtcgccaccgactactaccacgcggtgtggcaacgagaccgcactcaggtc
agcgccgcgttctcgctggcgaggctgcgccttgccgagtacgacagagcgggcgcggtg
gccgtgctcgaccaggttcccgcggtgtcgctgcactactacgcggcacggatcgcgacg
gtgcgcgtgttcgtcggtgacctcggcgagggcccgcccacctcgaccgatctggtcaac
gccttcctgcgccgtccagaactcaatctggagggcgacgaggaaaacggcggcgcgggc
cccgcgcgcgaccgcctcgacaccgaggtctacgaggccgcgttgcaccgcgccgttaag
agcggcgacggggaacggcgcaacgccgtaggggctcagctcgaacagtgcctgcgcgga
ttggccaggcaggcgagggacgccgagagccagggcgtgctgatcgatctcgccaacacc
gtacggccgaaaacctggttctga

DBGET integrated database retrieval system