KEGG   Prauserella marina: BAY61_14615Help
Entry
BAY61_14615       CDS       T04988                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pmad  Prauserella marina
Pathway
pmad00010  Glycolysis / Gluconeogenesis
pmad00020  Citrate cycle (TCA cycle)
pmad00620  Pyruvate metabolism
pmad01100  Metabolic pathways
pmad01110  Biosynthesis of secondary metabolites
pmad01120  Microbial metabolism in diverse environments
pmad01130  Biosynthesis of antibiotics
pmad01200  Carbon metabolism
Module
pmad_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pmad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAY61_14615
   00020 Citrate cycle (TCA cycle)
    BAY61_14615
   00620 Pyruvate metabolism
    BAY61_14615
Enzymes [BR:pmad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAY61_14615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C Peptidase_M23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ASR39292
LinkDB All DBs
Position
3139997..3141184
Genome map
AA seq 395 aa AA seqDB search
MPRLSDTMEDGVIVAWHKQVGDQVGKGEVLAEIETDKAIMELESYDEGILERVLVAEGER
VAIGTPIGIVGDGTGSASPAPVPAPAAVAATPLVAGAAAVVPDGERGPKSSPLARKVARE
LGVELAGVAGTGPGGRIIRRDVESAAREAADTPAPASAVSTVEAGEDTELVPLSSMRRVA
AKRLTESKQQAPHFYLTSAIDVTELLAFRGTVNATLAGAGGPKVSVNDLIVKAVAVALRE
NPDVNVSFAGDDLARHKRINLGIAVAVPDGLVVPVVPDADRKSVSEIAAEAREKGERARE
GKLKAAEMSGGTFTISNLGMFGIEQFAAVINPPEAAILAVGAAAEEVKVVEGEFVARKIL
RVTLSADHRAVDGATGARFLSTLTGLLEAPLRILA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgactgtccgacaccatggaggacggcgtcatcgtggcctggcacaaacaggta
ggcgaccaggtcggcaagggggaagtgctggccgagatcgagaccgacaaggccatcatg
gagctggagtcctacgacgaagggatactggagcgggtactcgtcgccgagggggagcgc
gtcgcgatcggtacccccatcgggatcgtcggagacgggaccggctcggcttcccccgcg
ccggtgccggctccggccgctgtcgccgccacgccgttggtggcgggggccgcggcggtc
gtgccggacggcgagcgagggccgaagtcctccccgctggcccgcaaggtcgccagggaa
ctgggcgtcgaactcgccggggtcgccggaacgggacccggcggccggatcatcaggcgc
gacgtcgaatccgcggcacgtgaggccgccgatacccccgcccccgcgtcagcagtatcc
actgtggaggcaggcgaggacaccgagctggtgccgttgagcagcatgcgccgggtggcg
gcgaagcggctcaccgaaagcaagcagcaggcgccgcacttctatttgaccagcgcgatc
gatgtgaccgagctgctggccttccggggcacggtcaacgcgaccctcgccggggccggg
ggacccaaggtcagcgtcaacgacctgatcgtgaaggcggtcgccgtcgcgctgcgggaa
aaccccgacgtcaacgtgtcgttcgccggtgacgatctggccaggcacaagcggatcaac
ctcggcatcgcggtcgcggtacccgatgggctcgtcgtgccggtcgtgcccgacgccgat
cgcaagagcgtctccgagatcgcggctgaggcgagggaaaagggggagcgggcccgcgag
ggcaaactcaaggccgccgagatgtcgggtggaaccttcacgatctccaacctcggcatg
ttcggcatcgagcagttcgccgccgtgatcaaccctccggaggccgcgattctcgccgtc
ggcgcggccgccgaggaagtcaaggtcgtcgaaggcgagttcgtggcccgcaagatcctg
cgcgtgacgctctcggccgatcaccgtgccgtcgacggcgcgaccggcgcccgtttcctg
agcaccctcaccggattgctggaggcaccgctgcgcatcctcgcctga

DBGET integrated database retrieval system