KEGG   Paraphotobacterium marinum: CF386_02115
Entry
CF386_02115       CDS       T05093                                 

Definition
(GenBank) hypothetical protein
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
pmai  Paraphotobacterium marinum
Pathway
pmai00471  D-Glutamine and D-glutamate metabolism
pmai00550  Peptidoglycan biosynthesis
pmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CF386_02115
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CF386_02115
Enzymes [BR:pmai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     CF386_02115
Peptidoglycan biosynthesis and degradation proteins [BR:pmai01011]
 Precursor biosynthesis
  Amino acid ligase
   CF386_02115
SSDB
Motif
Pfam: Mur_ligase_M
Other DBs
NCBI-ProteinID: ASK77926
UniProt: A0A220VCH1
LinkDB
Position
large:complement(392433..393092)
AA seq 219 aa
MTLHNKINKNLRVAVCGLGKTGISVIKFILENKLPWKIEAYDSKEVVDVYQFDNYINVSF
EGFDDSNVLKCDLIIVSPGININRGVFLEAKKNNIDIIGDIELFSYFTDKPVIAITGSNG
KSTVTQLTGDVLKAASLKVGIGGNIGIPALSLLDHDYELYVLELSSYQLETIENLKTKIS
VFLNLSEDHIERYASFYEYKMAKQKYLPKANYVFIIKMI
NT seq 660 nt   +upstreamnt  +downstreamnt
atgaccttacataataaaattaataaaaatttaagagtagctgtttgtggattgggaaag
acaggcatttctgttattaaatttatattagaaaacaaattgccttggaaaattgaagcc
tatgatagtaaggaagttgttgatgtttatcaatttgataattatataaacgtatctttt
gagggtttcgatgatagtaatgtattaaaatgtgatttgattattgtaagtcctggtata
aacattaatagaggtgttttcttagaagcaaaaaaaaataatattgacataattggtgat
attgaattattttcatattttacagataaacctgtaattgctataactggttcaaacggt
aaaagtacagtcacacagcttacgggtgatgttttaaaagcagcatcacttaaagttggt
ataggcggtaacattggtattccagctttatctcttttagaccatgactatgagctctat
gttttagagttatctagttatcaactagaaacaatagaaaacttaaaaactaaaatatcg
gttttcttaaatctttcagaagatcatatagaacgatatgcttcattttatgaatataaa
atggccaaacaaaaatatttaccaaaagcaaactatgtatttataatcaagatgatataa

DBGET integrated database retrieval system