KEGG   Paraphotobacterium marinum: CF386_02130
Entry
CF386_02130       CDS       T05093                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pmai  Paraphotobacterium marinum
Pathway
pmai00300  Lysine biosynthesis
pmai00550  Peptidoglycan biosynthesis
pmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    CF386_02130
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CF386_02130
Enzymes [BR:pmai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CF386_02130
Peptidoglycan biosynthesis and degradation proteins [BR:pmai01011]
 Precursor biosynthesis
  Amino acid ligase
   CF386_02130
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase
Other DBs
NCBI-ProteinID: ASK77929
UniProt: A0A220VC71
LinkDB
Position
large:complement(395511..397028)
AA seq 505 aa
MSSVNTTQVDFKLLIEPWIKINKSYLIKGLTINSQDVKKDFLFIAINGEKHTSNDFIKDA
IKNGATCILKETNSDLEDRSIEYSDNCLVVKIKNLKNILSDIGGRFYNYPSKNHRIIGVT
GTNGKTSITHIIAQWLDLLGQKSTIMGTNGSGELNNLKPSINTTGNPISIQKNIHDFVTI
GSKITAMEVSSHGLVQHRVKNINFDVGIFTNLSRDHLDYHKTMESYEKSKFLFFSTHNVK
NMVLNYDDLVGQKWSKKLNDCFLISIKNYDLSSLTKNYIYVKNIRYVGQKTLLICASHLT
EFEIEINLLGSFNITNVLLSLASLLLLGFKLDDLINTAEKLVSVEGRMEIFHNYDNPTVV
VDYAHTPDALHKALSSLSLKKGKIWCVFGCGGDRDRGKRVEMGRIADNLSDKLILTNDNP
RTEDPKLILDDIMSGIKDKTNLHVIPDRGKAIQYAIDKADQNDIIMVAGKGHENYQIIGD
KKIVFSDRDEVKKALGLKNDTNSIK
NT seq 1518 nt   +upstreamnt  +downstreamnt
attagttcagtgaatacaactcaagttgattttaaattattaattgaaccttggatcaaa
attaataaatcttatctaattaaggggttaacaataaatagtcaggatgttaagaaagac
tttttatttatagcaattaatggtgaaaaacacacatcaaacgattttattaaagatgct
atcaaaaatggagcaacttgtattttgaaggaaactaatagtgaccttgaagatagaagc
attgagtatagtgacaattgtcttgtggttaaaataaaaaacctaaaaaatatactctct
gatattggagggcgcttttataattatccgagtaaaaatcaccgtattattggtgtaaca
ggaactaatggtaaaacatcaattactcacataattgcgcagtggttggacttgttaggt
caaaaatctactattatgggtactaatggttctggtgaattgaataatttgaaaccgagt
ataaatactactggaaatccaataagtatccaaaaaaatatacacgattttgttacgatt
ggctctaaaattacagctatggaagtgtcatcacatggtttagtgcagcatagagttaaa
aatataaattttgatgttggaatttttactaatttaagtagagatcatctggattaccat
aaaacaatggaaagttatgagaaaagtaagttcctcttttttagtactcataatgttaaa
aatatggtattaaattatgatgatttagtgggtcaaaaatggagtaaaaaacttaatgat
tgttttcttatttcaataaaaaattatgatttatcatctttaactaaaaattatatttat
gtaaaaaatatacgatatgttgggcaaaaaacactacttatttgtgcctcacatttaact
gaatttgaaattgaaattaatttacttggatcatttaatattactaatgtacttttaagc
ttagcatctcttttattgcttggctttaagcttgatgatttgataaatacagcagaaaag
ttggtctccgttgaagggagaatggaaatttttcataattatgacaatccgaccgtagtt
gttgattatgctcacactcctgatgccctacataaagcattgagcagtctttccttaaaa
aaaggtaagatttggtgtgtattcggttgtggtggagatcgtgatcgaggaaaaagagta
gaaatgggacgtattgcagataatttatcagataaattgattttgacaaatgacaaccca
agaacggaagatcctaaattaattttagatgatattatgagcgggattaaagataaaaca
aatcttcatgttataccggatagaggaaaagctattcaatatgcaatagataaagcagat
caaaatgatattattatggttgctggaaaaggacatgaaaactatcaaattattggagat
aaaaaaatagttttctcagatagagatgaagtaaaaaaagctttagggttaaaaaatgat
accaattcaattaagtga

DBGET integrated database retrieval system