KEGG   Paraphotobacterium marinum: CF386_10330
Entry
CF386_10330       CDS       T05093                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pmai  Paraphotobacterium marinum
Pathway
pmai00473  D-Alanine metabolism
pmai00550  Peptidoglycan biosynthesis
pmai01100  Metabolic pathways
pmai01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pmai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CF386_10330
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CF386_10330
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CF386_10330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pmai01011]
    CF386_10330
Enzymes [BR:pmai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CF386_10330
Peptidoglycan biosynthesis and degradation proteins [BR:pmai01011]
 Precursor biosynthesis
  Amino acid ligase
   CF386_10330
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp
Other DBs
NCBI-ProteinID: ASK79447
UniProt: A0A220VGF8
LinkDB
Position
small:complement(684201..685187)
AA seq 328 aa
MNTKTIMLLCGGGESEHEISLKSSKYIEENLNNIPNVEYIKVEIKKNGWYCPNDDKVSFD
LDGNLNMTTSKLKIDYVIPCIHGYPGETGDIQSLLKMSNTPYLGCDSESSKICFNKVTTK
LWFDALGIKNTPYIFLQDQSEDALLEASNFLFEHEEVFVKAASQGSSIGCYKVDNIGELL
ESIKKAFTYSDVVLIEKCLKVRELEVAAYEMQDQLHVSFPGEIIAPQNSHYTFEEKYSAD
SQSVTHVKASNLTAQQVEIIDILSRKAFKFLNLKDLSRIDFFLTEDGEIYLNEINTFPGM
TEISMFPKMLIENGHSFQEYLKDKINAE
NT seq 987 nt   +upstreamnt  +downstreamnt
atgaatacaaaaacaataatgcttctttgtgggggcggtgagtcagagcacgaaatttct
ttaaaatcttcaaaatacatagaagaaaaccttaataatattcccaatgtagaatacatt
aaagttgaaatcaaaaaaaatggatggtattgcccaaatgatgataaggtgtcttttgat
ttagatggtaatttaaatatgacaacatctaagttaaaaattgattatgttatcccctgt
atccatggttatcctggagaaacaggagatattcaatctctccttaaaatgtctaataca
ccttatttgggttgtgactcagaatctagcaaaatttgttttaataaagtgacaactaaa
ttatggtttgatgcacttggtataaaaaatacaccttacatctttttgcaagatcaatct
gaagatgcattgcttgaagcttctaattttttatttgaacatgaagaggtttttgtaaaa
gcggcttctcaaggctcatcgattggttgttataaagtagataacattggagagctgtta
gaatctataaaaaaagcatttacttattcagatgtggtattaattgaaaaatgcctgaag
gttagagagcttgaagttgcagcgtatgaaatgcaagatcaattacatgtcagttttcct
ggtgaaatcattgcacctcaaaacagccattatacttttgaagaaaaatatagtgctgac
agtcaatcagtgacccatgtaaaagcctctaatttgacagcacagcaagttgagatcatt
gatattttatctcgaaaagctttcaaatttttaaatttaaaagatttatcacgcattgat
tttttcttaacggaagatggtgaaatttatttaaatgaaatcaatacatttccaggaatg
actgaaatatcgatgtttcccaagatgttaattgaaaatggacattcattccaagaatat
ctgaaagataaaataaatgctgaataa

DBGET integrated database retrieval system